Homologs in group_4626
0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product |
|---|
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| P15017 | 2.84e-09 | 53 | 31 | 1 | 98 | 4 | None | Uncharacterized transcriptional regulator in ATPase CF(0) region | Rhodospirillum rubrum |
| Q97QZ2 | 1.78e-07 | 49 | 38 | 0 | 67 | 1 | pezA | Antitoxin PezA | Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) |
| P0C5S2 | 6.56e-07 | 47 | 34 | 1 | 75 | 4 | R00410 | Uncharacterized HTH-type transcriptional regulator R00410 | Rhizobium meliloti (strain 1021) |
| A6U5H5 | 6.56e-07 | 47 | 34 | 1 | 75 | 4 | Smed_0045 | Uncharacterized HTH-type transcriptional regulator Smed_0045 | Sinorhizobium medicae (strain WSM419) |
| Q9ZD50 | 8.11e-07 | 47 | 36 | 0 | 71 | 4 | RP497 | Uncharacterized HTH-type transcriptional regulator RP497 | Rickettsia prowazekii (strain Madrid E) |
| Q92HV3 | 3.1e-06 | 45 | 35 | 0 | 71 | 4 | RC0668 | Uncharacterized HTH-type transcriptional regulator RC0668 | Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
| P06966 | 3.96e-06 | 45 | 33 | 0 | 66 | 4 | dicA | HTH-type transcriptional regulator DicA | Escherichia coli (strain K12) |
| P55681 | 2.17e-05 | 43 | 30 | 0 | 66 | 4 | NGR_a01020 | Uncharacterized HTH-type transcriptional regulator y4wC | Sinorhizobium fredii (strain NBRC 101917 / NGR234) |
| Q8TZX4 | 4.23e-05 | 43 | 38 | 0 | 52 | 3 | PF1851 | Putative HTH-type transcriptional regulatory protein PF1851 | Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) |
| Q9V1R0 | 0.001 | 40 | 36 | 0 | 52 | 3 | PYRAB03670 | Putative HTH-type transcriptional regulatory protein PYRAB03670 | Pyrococcus abyssi (strain GE5 / Orsay) |
| Source | Proteus mirabilis HI4320 |
|---|---|
| Locus tag | PMI_RS13470 |
| Feature type | CDS |
| Gene | - |
| Product | helix-turn-helix transcriptional regulator |
| Location | 2984615 - 2984932 (strand: 1) |
| Length | 318 (nucleotides) / 105 (amino acids) |
| Accession | NC_010554 |
|---|---|
| Length | 4063606 nucleotides |
| Topology | circular |
| Plasmid | False |
| Orthogroup | group_4626 | |
|---|---|---|
| Orthogroup size | 1 | |
| N. genomes | 1 |
| PF01381 | Helix-turn-helix |
|---|
| ID | Function(s) descr. | Function(s) cat. | Description |
|---|---|---|---|
| COG1396 | Transcription (K) | K | Transcriptional regulator, contains XRE-family HTH domain |
| KO | Description | Pathways | Modules |
|---|---|---|---|
| K18830 | HTH-type transcriptional regulator / antitoxin PezA | - | - |
MIDSSKTINFRIGQRIRHLRKNLKYSGKLFAKELGISQQQLSRYERGTNRISIEFVYLITEKFDVHISYFLQSNYMINIEQQRNIQEKNSLLIAEACIKNGTNRP
AGTCTCACTTTTTCTTATCAATAATGATTTGAATTTTTAAGGCTGATGAAATGATTGATAGCAGCAAAACGATTAATTTTCGTATAGGACAACGAATACGTCACTTGCGAAAAAATTTAAAATATTCGGGGAAACTATTTGCCAAAGAGTTAGGCATAAGTCAGCAACAACTTTCACGGTATGAACGAGGAACAAATAGGATCAGTATTGAGTTTGTTTATTTAATTACTGAAAAGTTTGATGTTCATATCAGCTATTTCTTACAAAGTAACTATATGATTAATATTGAGCAACAACGAAATATACAAGAAAAAAACAGCCTGCTGATTGCCGAGGCTTGTATAAAAAATGGCACTAATCGCCCTTAACTTAATTATCCTTTCGGTTCAAATACACACTGTCATCTATTTTATCGTTG
