Homologs in group_4620
0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product |
|---|
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| P0A226 | 2.14e-05 | 42 | 56 | 0 | 39 | 3 | mxiI | Protein MxiI | Shigella sonnei |
| P0A225 | 2.14e-05 | 42 | 56 | 0 | 39 | 1 | mxiI | Protein MxiI | Shigella flexneri |
| Source | Proteus mirabilis HI4320 |
|---|---|
| Locus tag | PMI_RS13305 |
| Feature type | CDS |
| Gene | sctI |
| Product | type III secretion system inner rod subunit SctI |
| Location | 2952144 - 2952422 (strand: 1) |
| Length | 279 (nucleotides) / 92 (amino acids) |
| Accession | NC_010554 |
|---|---|
| Length | 4063606 nucleotides |
| Topology | circular |
| Plasmid | False |
| Orthogroup | group_4620 | |
|---|---|---|
| Orthogroup size | 1 | |
| N. genomes | 1 |
| KO | Description | Pathways | Modules |
|---|---|---|---|
| K22487 | type III secretion system protein | Pathogenic Escherichia coli infection Shigellosis Salmonella infection |
- |
MAIAPIIPVNLTKELQDTSDDSLSTIMVNGIISSMQYEKKIQEKLTTLSQLGDAQSYTNLQIELSDYSITMSLASTLARKSLNIVETLLKAQ
ATGAGTATTATTGGTAATATGCGTTAACATGAGTTTTACGGAGGTTATGTATGGCTATTGCACCTATTATTCCCGTTAATTTAACCAAAGAACTACAAGATACAAGTGATGATAGTTTATCGACTATCATGGTAAATGGCATTATTAGTAGTATGCAATATGAAAAAAAGATACAAGAAAAGTTAACAACATTAAGCCAATTAGGTGATGCCCAAAGTTATACGAATTTACAAATAGAACTTAGCGATTATTCAATTACGATGAGCTTAGCGAGTACGTTAGCAAGAAAATCTCTCAATATTGTGGAAACACTACTTAAGGCTCAATAGTAATGAATAGACGGTATTTGTTATTACTATTTTTATGTTGCTTACTTCCT
