Homologs in group_4907

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4907

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4907

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AE59 8.13e-43 140 50 1 131 3 caiF Transcriptional activatory protein CaiF Shigella flexneri
P0AE58 8.13e-43 140 50 1 131 4 caiF Transcriptional activatory protein CaiF Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS13105
Feature type CDS
Gene caiF
Product carnitine metabolism transcriptional regulator CaiF
Location 2909675 - 2910067 (strand: -1)
Length 393 (nucleotides) / 130 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_4907
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF07180 CaiF/GrlA transcriptional regulator

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08277 transcriptional activator CaiF - -

Protein Sequence

MCEEDINKPLYLLIADWVQEQQRWVSAKEIAKNFDIPQCNAINIVSYILSDVKEIECDTKSVPNQLEGRGCQCQRMIKVSHIDPALYARLKGHTQSKSRLSAPEKLAAMIPHGLDHQQKWQWMLSKSQRR

Flanking regions ( +/- flanking 50bp)

CTTTATTTAGAGATAAATAAACTTTTATTTGTAATATTATTGGAGTAAATATGTGTGAAGAAGACATAAATAAACCACTCTACTTGTTAATTGCAGACTGGGTTCAAGAGCAGCAACGCTGGGTGAGCGCAAAAGAGATCGCTAAAAATTTTGATATCCCCCAATGTAATGCGATTAATATCGTTTCTTATATTCTTTCTGATGTAAAAGAGATTGAGTGTGATACCAAAAGCGTTCCTAATCAATTGGAAGGAAGAGGGTGCCAATGCCAAAGGATGATCAAAGTCAGTCATATTGATCCTGCTCTTTACGCTCGTTTAAAAGGTCATACGCAAAGTAAAAGTCGTTTAAGCGCCCCAGAGAAATTAGCCGCTATGATCCCTCATGGGCTGGATCACCAACAAAAATGGCAATGGATGTTGTCAAAATCACAACGGCGTTAATTGATAGCCGAGTGTTAAAATAAAGCAATACGACAGGCGTTTGTTGTGCC