Homologs in group_4611

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4611

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4611

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8Z9K8 3.59e-58 176 84 0 95 3 fixX Ferredoxin-like protein FixX Salmonella typhi
Q8ZRW8 5.4e-58 176 83 0 95 3 fixX Ferredoxin-like protein FixX Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q83SQ6 8.21e-57 172 83 0 95 3 fixX Ferredoxin-like protein FixX Shigella flexneri
P68646 2.75e-56 171 82 0 95 1 fixX Ferredoxin-like protein FixX Escherichia coli (strain K12)
P68647 2.75e-56 171 82 0 95 3 fixX Ferredoxin-like protein FixX Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P68648 2.75e-56 171 82 0 95 3 fixX Ferredoxin-like protein FixX Escherichia coli O157:H7
P77714 1.42e-40 132 58 0 94 3 ydiT Ferredoxin-like protein YdiT Escherichia coli (strain K12)
Q46905 7.05e-21 82 44 0 75 3 ygcO Ferredoxin-like protein YgcO Escherichia coli (strain K12)
P53658 7.2e-19 77 40 1 92 4 fixX Ferredoxin-like protein Azotobacter vinelandii
Q53207 7.71e-19 77 42 1 95 4 fixX Ferredoxin-like protein Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P10326 1.01e-18 76 39 2 93 4 fixX Ferredoxin-like protein Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P09823 2.26e-18 75 41 2 92 4 fixX Ferredoxin-like protein Rhizobium leguminosarum
P09822 1.39e-17 73 38 2 92 4 fixX Ferredoxin-like protein Rhizobium meliloti (strain 1021)
P26485 1.27e-16 71 38 1 92 4 fixX Ferredoxin-like protein Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q05561 3.84e-16 70 40 1 92 4 fixX Ferredoxin-like protein Rhizobium leguminosarum bv. phaseoli
P08710 3.35e-13 62 39 4 93 4 fixX Ferredoxin-like protein Rhizobium leguminosarum bv. trifolii

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS13055
Feature type CDS
Gene fixX
Product ferredoxin-like protein FixX
Location 2898550 - 2898837 (strand: -1)
Length 288 (nucleotides) / 95 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_4611
Orthogroup size 1
N. genomes 1

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2440 Energy production and conversion (C) C Ferredoxin-like protein FixX

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03855 ferredoxin like protein - -

Protein Sequence

MSSPVNVDVKLGINKFNVDEENPHIIIKQQPDMQVLDTLVKACPAGLYKKQQDGSVSFDYAGCLECGTCRILGLDSALEKWEYPRGTFGVEYRYG

Flanking regions ( +/- flanking 50bp)

GTGGGGTGGATGAATTTAATAAAAGATGGGATCAAAGGAGTAAAAGCAATATGAGTTCTCCTGTAAATGTCGATGTCAAATTGGGCATCAATAAATTTAATGTCGATGAAGAAAATCCACATATCATCATTAAACAGCAACCTGATATGCAAGTATTAGACACACTGGTAAAAGCTTGTCCTGCGGGTCTTTATAAAAAACAACAAGATGGTAGCGTCAGCTTTGATTATGCAGGGTGCTTAGAGTGTGGAACCTGTCGAATTCTCGGTTTAGACAGTGCGCTTGAAAAATGGGAATACCCACGCGGAACGTTTGGCGTGGAATATCGTTACGGATGATGTATCGCTACTTTTCTCCCAGCGCTGTCTCCGGCCTGGGAGCTTTTCTT