Homologs in group_1166

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06275 FBDBKF_06275 77.3 Morganella morganii S1 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH
EHELCC_09320 EHELCC_09320 77.3 Morganella morganii S2 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH
NLDBIP_09700 NLDBIP_09700 77.3 Morganella morganii S4 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH
LHKJJB_08055 LHKJJB_08055 77.3 Morganella morganii S3 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH
HKOGLL_07605 HKOGLL_07605 77.3 Morganella morganii S5 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH
F4V73_RS15645 F4V73_RS15645 78.0 Morganella psychrotolerans apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH

Distribution of the homologs in the orthogroup group_1166

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1166

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F2I4 0.0 566 100 0 273 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Proteus mirabilis (strain HI4320)
A4W6F5 1.27e-166 465 79 0 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Enterobacter sp. (strain 638)
A8ALQ2 1.84e-166 465 80 0 272 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P0A1B1 5.11e-165 461 80 0 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1B2 5.11e-165 461 80 0 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Salmonella typhi
A9MYM2 5.11e-165 461 80 0 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T6L4 5.11e-165 461 80 0 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Salmonella newport (strain SL254)
B4TJ45 5.11e-165 461 80 0 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Salmonella heidelberg (strain SL476)
B5RGC0 5.11e-165 461 80 0 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R1S6 5.11e-165 461 80 0 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Salmonella enteritidis PT4 (strain P125109)
B5FI32 5.11e-165 461 80 0 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Salmonella dublin (strain CT_02021853)
B5F769 5.11e-165 461 80 0 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Salmonella agona (strain SL483)
B5BL25 9.86e-165 460 80 0 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Salmonella paratyphi A (strain AKU_12601)
Q5PDE1 9.86e-165 460 80 0 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TWT4 2.45e-164 459 80 0 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Salmonella schwarzengrund (strain CVM19633)
Q57TH2 2.56e-164 459 79 0 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Salmonella choleraesuis (strain SC-B67)
Q6D0D8 2.63e-164 459 78 0 270 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B7LVU3 4.38e-164 459 78 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q3Z5W0 4.8e-164 458 78 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Shigella sonnei (strain Ss046)
Q326I4 4.8e-164 458 78 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Shigella boydii serotype 4 (strain Sb227)
B2U257 4.8e-164 458 78 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P05637 4.8e-164 458 78 0 271 1 apaH Bis(5'-nucleosyl)-tetraphosphatase [symmetrical] Escherichia coli (strain K12)
B1IRC7 4.8e-164 458 78 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XC50 4.8e-164 458 78 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Escherichia coli (strain K12 / DH10B)
C4ZPX5 4.8e-164 458 78 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Escherichia coli (strain K12 / MC4100 / BW2952)
B7L4H2 4.8e-164 458 78 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Escherichia coli (strain 55989 / EAEC)
B1LFY5 5.1e-164 459 78 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Escherichia coli (strain SMS-3-5 / SECEC)
B7NHF5 5.1e-164 459 78 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q83SQ2 7.69e-164 458 78 0 271 1 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Shigella flexneri
Q0T8E6 7.69e-164 458 78 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Shigella flexneri serotype 5b (strain 8401)
B6HZ30 7.69e-164 458 78 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Escherichia coli (strain SE11)
A7ZW01 7.69e-164 458 78 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Escherichia coli O9:H4 (strain HS)
B7M0E6 7.69e-164 458 78 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Escherichia coli O8 (strain IAI1)
A7ZHE2 7.69e-164 458 78 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Escherichia coli O139:H28 (strain E24377A / ETEC)
B7N7S4 7.86e-164 458 78 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q7N8V9 8.72e-164 457 77 0 269 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B5YZ87 8.92e-164 458 78 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XA15 8.92e-164 458 78 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Escherichia coli O157:H7
A7MIB2 9.56e-164 458 78 0 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Cronobacter sakazakii (strain ATCC BAA-894)
C0Q5E5 1.45e-163 457 79 0 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Salmonella paratyphi C (strain RKS4594)
A9MQG4 1.51e-163 457 79 0 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q0TLT8 2.27e-163 457 78 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MNQ8 2.27e-163 457 78 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Escherichia coli O81 (strain ED1a)
Q8FL98 2.64e-163 457 78 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7UI97 2.64e-163 457 78 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B5Y1Z6 3.75e-163 456 79 0 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Klebsiella pneumoniae (strain 342)
Q66ER0 4.57e-163 456 79 0 266 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K485 4.57e-163 456 79 0 266 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FMC3 4.88e-163 456 79 0 266 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q1RGE8 9.32e-163 455 77 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Escherichia coli (strain UTI89 / UPEC)
A1A798 9.32e-163 455 77 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Escherichia coli O1:K1 / APEC
B7MAH4 9.32e-163 455 77 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Escherichia coli O45:K1 (strain S88 / ExPEC)
B1JKY5 1.35e-162 455 79 0 266 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q32K45 1.48e-162 455 78 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Shigella dysenteriae serotype 1 (strain Sd197)
A4TQE0 1.8e-162 455 79 0 266 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Yersinia pestis (strain Pestoides F)
Q1CMT4 1.8e-162 455 79 0 266 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Yersinia pestis bv. Antiqua (strain Nepal516)
A9QZZ2 1.8e-162 455 79 0 266 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIK7 1.8e-162 455 79 0 266 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Yersinia pestis
Q1C0H7 1.8e-162 455 79 0 266 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Yersinia pestis bv. Antiqua (strain Antiqua)
A6T4I5 1.84e-162 454 79 0 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A1JJF2 2.44e-162 455 78 0 269 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C6DEY8 1.79e-161 452 77 0 266 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A8G9N8 1.68e-159 447 76 0 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Serratia proteamaculans (strain 568)
B2VGQ8 5.83e-158 443 75 0 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q2NVX8 9.74e-155 435 75 0 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Sodalis glossinidius (strain morsitans)
C5B7N9 8.86e-150 422 73 1 269 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Edwardsiella ictaluri (strain 93-146)
P27510 3.39e-148 417 79 0 245 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical (Fragment) Klebsiella aerogenes
Q1LSS3 4.45e-132 378 64 0 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Baumannia cicadellinicola subsp. Homalodisca coagulata
C4K4K8 5.17e-123 354 59 0 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
P57922 1.59e-109 320 56 0 269 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Pasteurella multocida (strain Pm70)
Q8K9Z9 5.53e-108 316 50 0 266 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A7N0G6 7.62e-108 316 55 3 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Vibrio campbellii (strain ATCC BAA-1116)
P44751 3.36e-107 314 54 0 269 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5U9U1 6.92e-107 313 54 0 269 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Haemophilus influenzae (strain PittEE)
B0URM8 2.79e-106 312 56 0 269 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Histophilus somni (strain 2336)
C3LRH2 8.48e-106 311 54 3 270 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Vibrio cholerae serotype O1 (strain M66-2)
Q9KUS4 8.48e-106 311 54 3 270 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F8N0 8.48e-106 311 54 3 270 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q0I5C4 2.62e-105 310 55 0 269 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Histophilus somni (strain 129Pt)
A5UH58 2.96e-105 310 54 0 269 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Haemophilus influenzae (strain PittGG)
B8D747 3.23e-105 309 50 0 270 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8D8U3 1.21e-104 308 50 0 270 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
P57242 2.31e-104 307 50 0 270 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q4QMZ7 4.4e-104 306 53 0 269 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Haemophilus influenzae (strain 86-028NP)
Q89AV3 9.4e-103 303 51 2 274 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q65UX2 9.59e-103 303 53 0 269 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
O52655 1.45e-102 303 53 0 269 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Aggregatibacter actinomycetemcomitans
B8F4P0 2.42e-102 302 52 0 269 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Glaesserella parasuis serovar 5 (strain SH0165)
A6VMA9 5.62e-102 301 53 0 269 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q8DED0 1.04e-101 300 54 3 272 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Vibrio vulnificus (strain CMCP6)
A1STS0 3.97e-101 299 53 2 265 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q7MP88 5.08e-101 298 54 3 272 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Vibrio vulnificus (strain YJ016)
Q7VLX9 1.17e-100 298 51 0 269 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q5E866 3.88e-100 296 54 2 270 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q87ST8 6.05e-100 296 53 3 270 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B6EL47 8.25e-100 295 52 2 274 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Aliivibrio salmonicida (strain LFI1238)
B0BP40 3.33e-99 294 52 0 269 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GXJ7 4.33e-99 293 52 0 269 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0C2 4.33e-99 293 52 0 269 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A6VU51 1.28e-98 293 53 0 267 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Marinomonas sp. (strain MWYL1)
Q47VJ7 1.3e-98 293 52 3 282 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
B5FGG4 3.64e-97 289 53 2 270 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Aliivibrio fischeri (strain MJ11)
C4L9L6 4.59e-96 286 52 0 264 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A4SR08 1.56e-95 285 50 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Aeromonas salmonicida (strain A449)
A0KGT6 2.49e-95 284 50 0 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q6LV43 3.69e-95 284 51 2 272 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Photobacterium profundum (strain SS9)
Q8D3I0 3.22e-91 274 46 1 267 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Wigglesworthia glossinidia brevipalpis
Q8EB91 4.99e-91 273 49 2 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HS04 1.5e-90 272 49 2 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Shewanella sp. (strain MR-7)
Q1IG22 4.93e-90 271 50 1 264 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Pseudomonas entomophila (strain L48)
A4XZJ6 6.83e-90 270 52 1 257 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Pseudomonas mendocina (strain ymp)
A0L066 1.14e-89 270 49 2 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Shewanella sp. (strain ANA-3)
Q4K4X3 4.5e-89 269 50 1 257 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q0HLT4 5.48e-89 268 48 2 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Shewanella sp. (strain MR-4)
A1RMV0 2.05e-88 266 46 2 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Shewanella sp. (strain W3-18-1)
A9L436 2.17e-88 266 46 2 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Shewanella baltica (strain OS195)
A4Y433 2.61e-88 266 46 2 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A6WK57 1.23e-87 265 46 2 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Shewanella baltica (strain OS185)
A3D186 1.37e-87 265 46 2 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EB37 2.43e-87 264 46 2 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Shewanella baltica (strain OS223)
C3K329 2.71e-87 264 48 2 268 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Pseudomonas fluorescens (strain SBW25)
Q07YJ6 3.81e-87 263 47 2 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Shewanella frigidimarina (strain NCIMB 400)
Q60CE9 4.38e-87 263 51 4 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B0KJ91 4.61e-87 264 50 1 264 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Pseudomonas putida (strain GB-1)
C5BPC0 1.22e-86 262 49 0 262 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q5P6P9 1.54e-86 262 49 3 265 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A4VHH8 2.4e-86 261 49 1 257 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Stutzerimonas stutzeri (strain A1501)
Q88QT8 4.45e-86 261 48 1 264 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5VXJ3 4.45e-86 261 48 1 264 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q9I5U7 1.59e-85 259 49 1 257 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02TH3 1.59e-85 259 49 1 257 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V4H6 1.59e-85 259 49 1 257 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Pseudomonas aeruginosa (strain LESB58)
B1JE09 1.98e-85 259 48 1 265 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Pseudomonas putida (strain W619)
Q3K5T0 2.59e-85 259 50 1 257 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Pseudomonas fluorescens (strain Pf0-1)
Q48NT9 6.65e-85 258 49 1 257 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q2YCK7 1.08e-84 257 48 2 264 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B3PKV6 1.54e-84 256 48 0 256 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Cellvibrio japonicus (strain Ueda107)
Q3JBF6 3.06e-84 256 48 1 258 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A6UZ94 3.47e-84 256 48 1 257 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Pseudomonas aeruginosa (strain PA7)
Q82WQ0 3.77e-84 256 45 2 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
C1DIX1 4.29e-84 256 49 1 264 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q88A48 5.79e-84 256 49 1 257 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B8GMY8 6.57e-84 255 47 1 257 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q1H450 3.47e-83 253 47 2 267 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A3QBA1 5.09e-83 253 45 2 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q4ZMG3 1.65e-82 252 48 1 257 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Pseudomonas syringae pv. syringae (strain B728a)
Q5ZRF6 3.61e-82 251 50 1 269 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IIB8 4.29e-82 251 50 1 269 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Legionella pneumophila (strain Corby)
Q5X0V3 4.29e-82 251 50 1 269 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Legionella pneumophila (strain Paris)
Q5WSM5 1.64e-81 249 50 1 269 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Legionella pneumophila (strain Lens)
A8FRV0 1.95e-81 249 47 2 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Shewanella sediminis (strain HAW-EB3)
Q3SMC6 2.04e-81 249 46 2 264 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Thiobacillus denitrificans (strain ATCC 25259)
Q0AC59 8.93e-81 247 46 3 270 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q21MT2 1.2e-80 247 47 1 265 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q1QZ29 3.65e-80 246 45 2 270 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q478S1 1.91e-79 244 48 3 265 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Dechloromonas aromatica (strain RCB)
A9BVD2 3.21e-78 241 42 3 272 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Delftia acidovorans (strain DSM 14801 / SPH-1)
Q7NQS0 5.09e-78 240 45 4 270 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q83AB7 1.11e-74 232 43 2 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9N9I1 1.11e-74 232 43 2 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KH04 4.37e-74 231 43 2 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Coxiella burnetii (strain Dugway 5J108-111)
B6J3B1 5.2e-74 231 43 2 266 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Coxiella burnetii (strain CbuG_Q212)
Q9JVF4 7.29e-74 229 45 2 259 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
B6J646 7.94e-74 230 43 2 271 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Coxiella burnetii (strain CbuK_Q154)
A1TLA3 2.67e-73 228 43 2 260 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Paracidovorax citrulli (strain AAC00-1)
B4RJQ3 3.68e-73 228 45 2 259 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Neisseria gonorrhoeae (strain NCCP11945)
Q5FA03 3.68e-73 228 45 2 259 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A1W551 1.74e-72 226 41 3 280 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Acidovorax sp. (strain JS42)
Q2SYI5 3.89e-72 225 45 3 255 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
B9MFH8 1.05e-71 224 43 2 260 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Acidovorax ebreus (strain TPSY)
A4G8L5 3.81e-71 223 42 2 261 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Herminiimonas arsenicoxydans
Q87C83 2.61e-70 221 44 3 259 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I5R6 2.61e-70 221 44 3 259 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Xylella fastidiosa (strain M23)
Q8PCE5 3.24e-70 222 44 3 259 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
A6T287 6.49e-70 219 41 2 261 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Janthinobacterium sp. (strain Marseille)
Q8PP27 7.29e-70 221 44 3 259 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Xanthomonas axonopodis pv. citri (strain 306)
Q9PBJ4 8.77e-70 220 43 3 259 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Xylella fastidiosa (strain 9a5c)
Q3BX84 3.28e-69 219 44 3 259 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q5GWB7 1.1e-68 218 44 3 259 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q7W3V0 1.42e-68 216 41 3 262 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WF80 1.42e-68 216 41 3 262 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7W041 1.77e-68 216 42 3 260 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
B2SPT1 1.78e-68 217 44 3 259 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZI2 1.86e-68 217 44 3 259 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A1V209 6.29e-68 215 45 3 255 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Burkholderia mallei (strain SAVP1)
Q9AEV8 6.29e-68 215 45 3 255 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Burkholderia mallei (strain ATCC 23344)
A2S9T5 6.29e-68 215 45 3 255 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Burkholderia mallei (strain NCTC 10229)
A3MMA4 6.29e-68 215 45 3 255 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Burkholderia mallei (strain NCTC 10247)
P0DMK2 2.63e-67 213 45 3 255 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Burkholderia pseudomallei (strain K96243)
I1WGA2 2.63e-67 213 45 3 255 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Burkholderia pseudomallei (strain 1026b)
Q3JPG7 2.63e-67 213 45 3 255 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Burkholderia pseudomallei (strain 1710b)
A3NYF9 2.63e-67 213 45 3 255 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Burkholderia pseudomallei (strain 1106a)
A3NCP7 2.69e-67 213 45 3 255 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Burkholderia pseudomallei (strain 668)
A9I1T6 5.03e-66 210 40 3 262 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
B2JFC8 1.03e-63 204 39 3 256 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q8Y1K9 5.94e-60 194 42 5 256 3 apaH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q9K907 7.21e-13 70 25 9 283 3 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q65LA0 4.72e-10 62 25 11 282 3 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A4IL88 5.09e-10 61 24 9 295 3 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Geobacillus thermodenitrificans (strain NG80-2)
A7Z3F2 1.36e-09 60 25 12 277 3 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B7GLK2 1.78e-09 60 24 8 285 3 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Anoxybacillus flavithermus (strain DSM 21510 / WK1)
O31614 2.42e-09 59 24 12 292 1 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Bacillus subtilis (strain 168)
Q5L1R3 1.18e-08 57 22 8 289 3 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Geobacillus kaustophilus (strain HTA426)
Q8ZMH3 1.24e-08 57 31 3 126 1 pphB Serine/threonine-protein phosphatase 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZNY9 4.18e-08 55 41 1 65 1 pphA Serine/threonine-protein phosphatase 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ERS7 1.53e-07 54 23 9 287 3 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q73BU4 3.66e-07 53 28 5 145 3 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Bacillus cereus (strain ATCC 10987 / NRS 248)
B9IU03 4.1e-07 53 27 5 157 3 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Bacillus cereus (strain Q1)
C5D7A6 6.89e-07 52 22 9 295 3 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Geobacillus sp. (strain WCH70)
B7ILE8 1.12e-06 52 22 9 286 3 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Bacillus cereus (strain G9842)
Q81GJ7 1.46e-06 51 22 9 286 3 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P40152 1.76e-06 52 22 11 272 1 PPN2 Zinc-dependent endopolyphosphatase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B7HGW3 1.87e-06 51 22 9 286 3 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Bacillus cereus (strain B4264)
B7JEP5 6.55e-06 49 22 9 291 3 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Bacillus cereus (strain AH820)
Q6HLX9 7.05e-06 49 27 5 146 3 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63EG2 7.53e-06 49 27 5 146 3 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Bacillus cereus (strain ZK / E33L)
B7I0B6 7.96e-06 49 27 5 146 3 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Bacillus cereus (strain AH187)
P03772 8.36e-06 49 35 1 68 1 None Serine/threonine-protein phosphatase Escherichia phage lambda
Q81TQ0 1.01e-05 49 21 9 291 3 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Bacillus anthracis
C3LBR5 1.01e-05 49 21 9 291 3 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P3Q5 1.01e-05 49 21 9 291 3 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Bacillus anthracis (strain A0248)
C1ELB5 2.17e-05 48 22 9 291 3 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Bacillus cereus (strain 03BB102)
A0RB32 2.32e-05 48 22 9 291 3 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Bacillus thuringiensis (strain Al Hakam)
P55799 4.09e-05 47 38 1 71 1 pphB Serine/threonine-protein phosphatase 2 Escherichia coli (strain K12)
A7GM94 5.05e-05 47 20 8 286 3 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
P55798 5.68e-05 46 39 1 64 1 pphA Serine/threonine-protein phosphatase 1 Escherichia coli (strain K12)
A9VJS5 0.000165 45 22 10 290 3 prpE Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical] Bacillus mycoides (strain KBAB4)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS11555
Feature type CDS
Gene apaH
Product bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH
Location 2548466 - 2549287 (strand: 1)
Length 822 (nucleotides) / 273 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1166
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00149 Calcineurin-like phosphoesterase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0639 Signal transduction mechanisms (T) T Diadenosine tetraphosphatase ApaH/serine/threonine protein phosphatase, PP2A family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01525 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [EC:3.6.1.41] Purine metabolism
Metabolic pathways
-

Protein Sequence

MATYLIGDVHGCYRELRQLLNQVNFDANQDTLWLTGDLVARGPDSLEVLRFVKSLGSALKLVLGNHDLHLLGVFAKISRNKPKDKLNELLNAPDADELINWLRRQPLLQVDEEKKIVMAHAGITPQWDLATAKKCAREVEAILSSDSYPLFINSMYGDMPNNWSPELTGLPRLRFSTNAFTRMRYCFPNGQLDMICKDKPENAPAPLKPWFDLPNQLPNDYSIIFGHWASLEGKGTPENIYALDTGCCWGGVLTCLRWEDKRYFIQPSLTHLP

Flanking regions ( +/- flanking 50bp)

ATTGACATCCCTGTTTTCCGCCTTGCTATCCCTACATTGATAAATTAATTATGGCTACTTATTTAATTGGCGATGTTCACGGCTGTTATCGTGAATTACGCCAACTTCTCAATCAAGTTAATTTCGACGCCAATCAAGATACACTTTGGTTAACGGGGGATCTGGTTGCTCGAGGACCTGATTCACTTGAAGTATTGCGTTTTGTCAAAAGCTTAGGCTCAGCGTTAAAACTCGTATTAGGGAATCACGATCTGCATCTACTGGGGGTATTTGCAAAGATTAGTCGTAATAAACCCAAAGATAAGCTTAATGAATTACTCAATGCACCAGATGCTGATGAATTAATTAATTGGTTACGACGTCAACCGCTATTACAAGTTGATGAAGAAAAGAAAATCGTTATGGCACACGCAGGTATTACCCCTCAGTGGGATTTAGCAACAGCTAAAAAATGTGCCCGAGAAGTAGAAGCCATATTAAGTAGCGATAGTTACCCCCTTTTCATTAATTCCATGTATGGTGATATGCCCAATAATTGGTCACCCGAATTAACTGGCTTACCGCGATTACGCTTTAGCACCAATGCTTTTACTCGTATGCGCTATTGTTTTCCTAACGGGCAGTTGGATATGATTTGTAAAGATAAGCCTGAAAATGCGCCTGCGCCATTAAAACCTTGGTTTGATTTACCTAATCAACTACCAAATGATTACAGTATTATCTTTGGCCACTGGGCCTCTTTAGAGGGAAAAGGCACCCCTGAAAATATCTATGCGCTAGATACTGGGTGTTGCTGGGGCGGTGTTCTAACCTGTCTACGTTGGGAAGACAAACGTTATTTTATCCAACCTAGTCTCACACACTTACCATAATTTTGTAGCGTTAAGATAGCATAGGTGTTGATTTATTTTACTATGCTATC