Homologs in group_3905

Help

1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
PMI_RS11065 PMI_RS11065 32.7 Proteus mirabilis HI4320 cysD sulfate adenylyltransferase subunit CysD

Distribution of the homologs in the orthogroup group_3905

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3905

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F233 0.0 499 100 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Proteus mirabilis (strain HI4320)
A1JJS4 5.72e-137 387 75 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2VG05 4.47e-134 380 73 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q7MB85 5.64e-134 380 72 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1JJG7 1.08e-133 379 73 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66ED2 1.08e-133 379 73 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K567 1.08e-133 379 73 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FLY8 1.08e-133 379 73 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A9N2E4 4.28e-133 377 73 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5RDR9 4.28e-133 377 73 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QW34 4.28e-133 377 73 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Salmonella enteritidis PT4 (strain P125109)
B5FTU1 4.28e-133 377 73 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Salmonella dublin (strain CT_02021853)
B4TTX7 5.63e-133 377 73 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Salmonella schwarzengrund (strain CVM19633)
B5F429 9.31e-133 377 73 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Salmonella agona (strain SL483)
B4TFY3 1.01e-132 377 73 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Salmonella heidelberg (strain SL476)
P17853 1.98e-132 376 72 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q2NVN2 2.55e-132 375 73 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Sodalis glossinidius (strain morsitans)
Q8Z460 3.79e-132 375 73 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Salmonella typhi
A8G9X8 4.27e-132 375 71 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Serratia proteamaculans (strain 568)
Q57KH9 5.26e-132 375 72 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Salmonella choleraesuis (strain SC-B67)
B5BEZ7 7.15e-132 374 72 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Salmonella paratyphi A (strain AKU_12601)
Q5PEH9 7.15e-132 374 72 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A8ANW8 7.23e-132 374 72 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A7MJ65 1.13e-131 374 71 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Cronobacter sakazakii (strain ATCC BAA-894)
B4T473 2.6e-131 373 72 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Salmonella newport (strain SL254)
Q5NRM3 3e-131 373 71 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
C6DDH2 3.91e-131 372 72 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B5XV26 1.3e-130 371 71 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Klebsiella pneumoniae (strain 342)
A6TD47 2.07e-130 371 72 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B6I6F6 7.44e-130 369 71 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Escherichia coli (strain SE11)
B7LXH5 7.44e-130 369 71 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Escherichia coli O8 (strain IAI1)
B7LEI1 7.44e-130 369 71 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Escherichia coli (strain 55989 / EAEC)
A7ZQK5 7.44e-130 369 71 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q6D1A3 1.22e-129 369 71 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8FEI9 1.85e-129 368 71 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TEA4 1.85e-129 368 71 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7UHH4 1.85e-129 368 71 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q7UBT0 1.97e-129 368 70 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Shigella flexneri
B1LQ85 1.97e-129 368 70 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Escherichia coli (strain SMS-3-5 / SECEC)
B7NT99 1.97e-129 368 70 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q3YY96 2.06e-129 368 71 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Shigella sonnei (strain Ss046)
Q31XM6 2.06e-129 368 71 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Shigella boydii serotype 4 (strain Sb227)
B2TZH2 2.06e-129 368 71 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A8A3P3 2.06e-129 368 71 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Escherichia coli O9:H4 (strain HS)
Q0T1I6 3.49e-129 368 70 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Shigella flexneri serotype 5b (strain 8401)
B7LWP0 5.53e-129 367 70 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7N6Z6 5.53e-129 367 70 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P17854 5.53e-129 367 70 0 243 1 cysH Phosphoadenosine 5'-phosphosulfate reductase Escherichia coli (strain K12)
B1IUR7 5.53e-129 367 70 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XDH5 5.53e-129 367 70 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Escherichia coli (strain K12 / DH10B)
C4ZZR6 5.53e-129 367 70 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Escherichia coli (strain K12 / MC4100 / BW2952)
B5Z3C5 9.15e-129 367 70 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X7U3 9.15e-129 367 70 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Escherichia coli O157:H7
Q1R7T6 9.77e-129 367 70 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Escherichia coli (strain UTI89 / UPEC)
A1AEU8 9.77e-129 367 70 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Escherichia coli O1:K1 / APEC
B7MYR0 9.77e-129 367 70 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Escherichia coli O81 (strain ED1a)
B7MKM9 9.77e-129 367 70 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q32CG5 2.68e-128 365 70 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Shigella dysenteriae serotype 1 (strain Sd197)
A9MF18 6.5e-128 364 70 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q7MHA7 5.21e-127 363 71 0 242 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Vibrio vulnificus (strain YJ016)
Q8CWK6 1.06e-126 362 70 0 242 1 cysH Phosphoadenosine 5'-phosphosulfate reductase Vibrio vulnificus (strain CMCP6)
A4WDV9 3.7e-126 360 73 0 228 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Enterobacter sp. (strain 638)
Q87L92 1.28e-125 359 69 0 242 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C3LRB8 1.67e-124 356 69 0 239 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Vibrio cholerae serotype O1 (strain M66-2)
Q9KUX2 1.67e-124 356 69 0 239 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F3I6 1.67e-124 356 69 0 239 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A7MSZ6 7.27e-124 355 68 0 242 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Vibrio campbellii (strain ATCC BAA-1116)
Q1LTP3 2.58e-121 348 68 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q5E839 2e-118 341 65 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5FGJ0 2.54e-118 340 65 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Aliivibrio fischeri (strain MJ11)
B7VI86 2.27e-117 338 69 0 228 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Vibrio atlanticus (strain LGP32)
Q6LM60 1.73e-115 333 64 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Photobacterium profundum (strain SS9)
B6ELM6 2.77e-112 325 62 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Aliivibrio salmonicida (strain LFI1238)
B4RYS5 4.85e-112 324 64 0 232 3 cysH1 Phosphoadenosine 5'-phosphosulfate reductase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q8EB01 7.17e-110 319 62 0 242 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B8D7V6 3.47e-107 312 62 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57501 1.87e-106 310 62 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9K4 2.11e-106 310 62 0 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q0A6T1 1.66e-104 305 60 0 223 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q8P607 5.97e-103 301 57 1 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RPG5 5.97e-103 301 57 1 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Xanthomonas campestris pv. campestris (strain B100)
Q4UY09 5.97e-103 301 57 1 243 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Xanthomonas campestris pv. campestris (strain 8004)
B2SI06 1.74e-102 300 60 0 223 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P0H1 1.74e-102 300 60 0 223 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BPY3 2.12e-102 300 60 0 223 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PHC7 4.57e-102 299 60 0 223 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Xanthomonas axonopodis pv. citri (strain 306)
P52672 3.5e-98 289 62 0 223 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Thiocapsa roseopersicina
B0U6V9 4.08e-97 286 59 0 223 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Xylella fastidiosa (strain M12)
Q9PD82 2.18e-96 284 59 0 223 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Xylella fastidiosa (strain 9a5c)
Q87DH1 2.69e-95 281 58 0 223 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2IA30 2.69e-95 281 58 0 223 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Xylella fastidiosa (strain M23)
P72794 5.85e-78 238 51 2 227 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q5N1N0 7.53e-76 232 50 2 225 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q55309 7.53e-76 232 50 2 225 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
B1XN08 8.83e-74 227 49 2 226 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q9KCT3 2.05e-35 129 32 6 231 3 cysH Adenosine 5'-phosphosulfate reductase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9ADG3 2.42e-33 123 32 6 234 3 cysH Adenosine 5'-phosphosulfate reductase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
B7INB4 5.87e-31 117 31 6 237 3 cysH Adenosine 5'-phosphosulfate reductase Bacillus cereus (strain G9842)
A9VLI9 1.27e-30 116 31 6 224 3 cysH Adenosine 5'-phosphosulfate reductase Bacillus mycoides (strain KBAB4)
C1EMR8 2.24e-30 115 31 6 224 3 cysH Adenosine 5'-phosphosulfate reductase Bacillus cereus (strain 03BB102)
B7HKE5 4.02e-30 115 31 6 224 3 cysH Adenosine 5'-phosphosulfate reductase Bacillus cereus (strain AH187)
Q6HLD4 4.19e-30 115 31 7 233 3 cysH Adenosine 5'-phosphosulfate reductase Bacillus thuringiensis subsp. konkukian (strain 97-27)
B7HHH6 4.76e-30 115 30 6 237 3 cysH Adenosine 5'-phosphosulfate reductase Bacillus cereus (strain B4264)
Q81FZ1 6.54e-30 114 30 6 237 3 cysH Adenosine 5'-phosphosulfate reductase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q10270 6.57e-30 115 32 7 228 3 met16 Probable phosphoadenosine phosphosulfate reductase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q73B76 6.61e-30 114 31 6 224 3 cysH Adenosine 5'-phosphosulfate reductase Bacillus cereus (strain ATCC 10987 / NRS 248)
A0RBN2 7.28e-30 114 31 6 224 3 cysH Adenosine 5'-phosphosulfate reductase Bacillus thuringiensis (strain Al Hakam)
B1HXC6 7.49e-30 114 32 7 227 3 cysH Adenosine 5'-phosphosulfate reductase Lysinibacillus sphaericus (strain C3-41)
B7JG06 1.14e-29 114 31 6 224 3 cysH Adenosine 5'-phosphosulfate reductase Bacillus cereus (strain AH820)
B7GG21 1.49e-29 113 30 6 219 3 cysH Adenosine 5'-phosphosulfate reductase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q63DV9 2.89e-29 112 31 7 233 3 cysH Adenosine 5'-phosphosulfate reductase Bacillus cereus (strain ZK / E33L)
B9IV11 2.98e-29 112 31 6 224 3 cysH Adenosine 5'-phosphosulfate reductase Bacillus cereus (strain Q1)
A7GMW0 4.37e-29 112 31 7 234 3 cysH Adenosine 5'-phosphosulfate reductase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q2S5G4 2.58e-28 110 32 6 230 3 cysH Adenosine 5'-phosphosulfate reductase Salinibacter ruber (strain DSM 13855 / M31)
C1AUL1 3.31e-28 110 33 5 200 3 cysH Adenosine 5'-phosphosulfate reductase Rhodococcus opacus (strain B4)
P18408 5.33e-28 110 29 10 257 1 MET16 Phosphoadenosine phosphosulfate reductase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q5WKF5 1.22e-27 108 30 7 234 3 cysH Adenosine 5'-phosphosulfate reductase Shouchella clausii (strain KSM-K16)
Q81T49 3.71e-27 107 30 6 222 3 cysH Adenosine 5'-phosphosulfate reductase Bacillus anthracis
C3L9N6 3.71e-27 107 30 6 222 3 cysH Adenosine 5'-phosphosulfate reductase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P516 3.71e-27 107 30 6 222 3 cysH Adenosine 5'-phosphosulfate reductase Bacillus anthracis (strain A0248)
Q7NK24 4.74e-27 107 31 6 209 3 cysH Phosphoadenosine 5'-phosphosulfate reductase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q5L2X9 2.49e-26 105 31 7 221 3 cysH Adenosine 5'-phosphosulfate reductase Geobacillus kaustophilus (strain HTA426)
C1A1H0 1.91e-25 103 31 5 200 3 cysH Adenosine 5'-phosphosulfate reductase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q8CMX3 2.68e-25 102 29 6 227 3 cysH Adenosine 5'-phosphosulfate reductase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HKZ5 2.76e-25 102 29 6 227 3 cysH Adenosine 5'-phosphosulfate reductase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A4IKB7 2.78e-25 102 29 6 219 3 cysH Adenosine 5'-phosphosulfate reductase Geobacillus thermodenitrificans (strain NG80-2)
P56859 3.93e-25 103 29 8 229 3 sA Phosphoadenosine phosphosulfate reductase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
C5D5A7 1.98e-24 100 29 6 219 3 cysH Adenosine 5'-phosphosulfate reductase Geobacillus sp. (strain WCH70)
Q98GP9 2e-24 100 29 5 232 3 cysH Adenosine 5'-phosphosulfate reductase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A8FD22 2.37e-24 100 31 6 218 3 cysH Adenosine 5'-phosphosulfate reductase Bacillus pumilus (strain SAFR-032)
O06737 2.89e-24 99 30 6 210 3 cysH1 Adenosine 5'-phosphosulfate reductase 2 Bacillus subtilis (strain 168)
Q8UH67 2.99e-24 100 31 5 206 1 cysH Adenosine 5'-phosphosulfate reductase Agrobacterium fabrum (strain C58 / ATCC 33970)
P94498 7.51e-24 98 31 6 218 1 cysH Adenosine 5'-phosphosulfate reductase 1 Bacillus subtilis (strain 168)
Q8EQP2 1.32e-23 98 29 6 219 3 cysH Adenosine 5'-phosphosulfate reductase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q11B66 1.68e-23 98 33 5 193 3 cysH Adenosine 5'-phosphosulfate reductase Chelativorans sp. (strain BNC1)
A0R0W2 2.21e-23 97 29 5 219 1 cysH Adenosine 5'-phosphosulfate reductase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A7Z4H7 2.84e-23 97 32 7 221 3 cysH Adenosine 5'-phosphosulfate reductase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B1MN34 3.69e-23 97 30 5 219 3 cysH Adenosine 5'-phosphosulfate reductase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q4L9F3 5.53e-23 96 28 6 227 3 cysH Adenosine 5'-phosphosulfate reductase Staphylococcus haemolyticus (strain JCSC1435)
P56891 1.29e-22 96 29 8 244 1 cysH Adenosine 5'-phosphosulfate reductase Rhizobium meliloti (strain 1021)
I3X057 1.94e-21 92 29 7 228 1 cysH Adenosine 5'-phosphosulfate reductase Sinorhizobium fredii (strain USDA 257)
C3MIE1 1.04e-20 90 31 6 208 1 cysH Adenosine 5'-phosphosulfate reductase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9JRT1 1.25e-20 90 28 8 232 3 cysH1 Adenosine 5'-phosphosulfate reductase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P9WIK3 3.02e-20 89 30 6 200 1 cysH Adenosine 5'-phosphosulfate reductase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIK2 3.02e-20 89 30 6 200 3 cysH Adenosine 5'-phosphosulfate reductase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U586 3.02e-20 89 30 6 200 3 cysH Adenosine 5'-phosphosulfate reductase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AQV5 3.02e-20 89 30 6 200 3 cysH Adenosine 5'-phosphosulfate reductase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KL82 3.02e-20 89 30 6 200 3 cysH Adenosine 5'-phosphosulfate reductase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P65669 3.02e-20 89 30 6 200 3 cysH Adenosine 5'-phosphosulfate reductase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
O33579 3.09e-20 87 33 5 173 3 cysH Adenosine 5'-phosphosulfate reductase (Fragment) Rhizobium tropici
D3RNJ4 2.89e-19 87 27 5 204 3 cysH Adenosine 5'-phosphosulfate reductase Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
Q49UL7 2.9e-19 86 26 7 242 3 cysH Adenosine 5'-phosphosulfate reductase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9JUD5 2.55e-18 84 27 8 232 3 cysH Adenosine 5'-phosphosulfate reductase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q02KP7 1.05e-16 80 27 5 251 3 cysH Adenosine 5'-phosphosulfate reductase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7VBC3 1.05e-16 80 27 5 251 3 cysH Adenosine 5'-phosphosulfate reductase Pseudomonas aeruginosa (strain LESB58)
O05927 1.24e-16 80 27 5 251 1 cysH Adenosine 5'-phosphosulfate reductase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P92980 1.67e-16 81 27 7 239 2 APR3 5'-adenylylsulfate reductase 3, chloroplastic Arabidopsis thaliana
P56860 5.45e-16 78 28 5 207 3 cysH Adenosine 5'-phosphosulfate reductase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q6Z4A7 2.14e-15 78 28 4 184 2 APR1 Probable 5'-adenylylsulfate reductase 1, chloroplastic Oryza sativa subsp. japonica
P92981 2.47e-15 78 25 6 237 1 APR2 5'-adenylylsulfate reductase 2, chloroplastic Arabidopsis thaliana
Q9RFS6 2.74e-15 76 27 5 204 3 cysH Adenosine 5'-phosphosulfate reductase Burkholderia cepacia
P92979 3.65e-15 77 26 7 236 1 APR1 5'-adenylylsulfate reductase 1, chloroplastic Arabidopsis thaliana
Q58383 9.49e-09 58 25 7 177 3 MJ0973 Uncharacterized protein MJ0973 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
B4F231 1.45e-08 57 25 9 249 3 cysD Sulfate adenylyltransferase subunit 2 Proteus mirabilis (strain HI4320)
A6VXC5 3.43e-08 56 25 5 190 3 cysD Sulfate adenylyltransferase subunit 2 Marinomonas sp. (strain MWYL1)
Q39EM7 7.33e-07 52 24 5 190 3 cysD Sulfate adenylyltransferase subunit 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q5NRM5 7.79e-07 52 24 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A0L6E2 1.28e-06 52 25 6 194 3 cysD Sulfate adenylyltransferase subunit 2 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q11K42 1.71e-06 51 24 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Chelativorans sp. (strain BNC1)
Q985Q5 3.38e-06 50 23 4 186 3 cysD Sulfate adenylyltransferase subunit 2 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B2VG02 4.31e-06 50 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B8D7V4 4.31e-06 50 25 8 224 3 cysD Sulfate adenylyltransferase subunit 2 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57499 4.31e-06 50 25 8 224 3 cysD Sulfate adenylyltransferase subunit 2 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9K2 4.31e-06 50 25 8 224 3 cysD Sulfate adenylyltransferase subunit 2 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q21IS4 4.61e-06 50 23 4 186 3 cysD Sulfate adenylyltransferase subunit 2 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B0V9N5 4.67e-06 50 25 6 186 3 cysD Sulfate adenylyltransferase subunit 2 Acinetobacter baumannii (strain AYE)
B0VSD7 4.67e-06 50 25 6 186 3 cysD Sulfate adenylyltransferase subunit 2 Acinetobacter baumannii (strain SDF)
C6DDH0 4.95e-06 50 24 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D1A5 5.24e-06 50 24 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6FDA0 6.28e-06 49 25 6 186 3 cysD Sulfate adenylyltransferase subunit 2 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q0C438 7.77e-06 49 24 4 186 3 cysD Sulfate adenylyltransferase subunit 2 Hyphomonas neptunium (strain ATCC 15444)
Q604B7 8.17e-06 49 24 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q9A881 1.1e-05 49 22 4 190 3 cysD Sulfate adenylyltransferase subunit 2 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A8A3N1 1.13e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Escherichia coli O9:H4 (strain HS)
A8ANW6 1.21e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q32CH8 1.37e-05 48 24 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Shigella dysenteriae serotype 1 (strain Sd197)
Q1R7T9 1.38e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Escherichia coli (strain UTI89 / UPEC)
Q8FEJ0 1.38e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AEU6 1.38e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Escherichia coli O1:K1 / APEC
B7MKM6 1.38e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Escherichia coli O45:K1 (strain S88 / ExPEC)
Q0T1I3 1.42e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Shigella flexneri serotype 5b (strain 8401)
B7LWK3 1.42e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B6I6E2 1.42e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Escherichia coli (strain SE11)
B7N6Y2 1.42e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7MZ53 1.42e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Escherichia coli O81 (strain ED1a)
B7UHH1 1.42e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZQJ6 1.42e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Escherichia coli O139:H28 (strain E24377A / ETEC)
Q3YYB0 1.45e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Shigella sonnei (strain Ss046)
B1LQ73 1.45e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Escherichia coli (strain SMS-3-5 / SECEC)
P21156 1.45e-05 48 23 5 186 1 cysD Sulfate adenylyltransferase subunit 2 Escherichia coli (strain K12)
B1IUS7 1.45e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XCS8 1.45e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Escherichia coli (strain K12 / DH10B)
C4ZZQ6 1.45e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Escherichia coli (strain K12 / MC4100 / BW2952)
B7LXG4 1.45e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Escherichia coli O8 (strain IAI1)
B7NT96 1.45e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7LEH0 1.45e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Escherichia coli (strain 55989 / EAEC)
Q4KI67 1.5e-05 48 25 6 190 3 cysD Sulfate adenylyltransferase subunit 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q0TEA6 1.52e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P59740 1.53e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Shigella flexneri
Q31XB4 1.53e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Shigella boydii serotype 4 (strain Sb227)
B2TZH9 1.59e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A6TD44 1.74e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XV29 1.74e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Klebsiella pneumoniae (strain 342)
A4WDV7 1.97e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Enterobacter sp. (strain 638)
B4TTW6 1.99e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Salmonella schwarzengrund (strain CVM19633)
P65672 2.06e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P65673 2.06e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Salmonella typhi
B5BEY9 2.06e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Salmonella paratyphi A (strain AKU_12601)
A9N2D9 2.06e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PEH1 2.06e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T462 2.06e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Salmonella newport (strain SL254)
B4TFX2 2.06e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Salmonella heidelberg (strain SL476)
B5RDQ8 2.06e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QW23 2.06e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Salmonella enteritidis PT4 (strain P125109)
B5FTT0 2.06e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Salmonella dublin (strain CT_02021853)
Q57KI9 2.06e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Salmonella choleraesuis (strain SC-B67)
B5F416 2.06e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Salmonella agona (strain SL483)
C1DQ71 2.08e-05 48 24 6 190 3 cysD Sulfate adenylyltransferase subunit 2 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A7MJ68 2.14e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Cronobacter sakazakii (strain ATCC BAA-894)
Q4ZNW4 2.16e-05 48 24 6 190 3 cysD Sulfate adenylyltransferase subunit 2 Pseudomonas syringae pv. syringae (strain B728a)
Q87WW0 2.16e-05 48 24 6 190 1 cysD Sulfate adenylyltransferase subunit 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8NFF5 2.3e-05 48 30 3 101 1 FLAD1 FAD synthase Homo sapiens
Q60377 2.31e-05 48 23 6 192 3 MJ0066 Uncharacterized protein MJ0066 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
C3KDP1 2.32e-05 48 25 6 190 3 cysD Sulfate adenylyltransferase subunit 2 Pseudomonas fluorescens (strain SBW25)
P72338 2.38e-05 48 22 4 186 3 nodP Sulfate adenylyltransferase subunit 2 Rhizobium sp. (strain N33)
Q48ED3 2.45e-05 48 24 6 190 3 cysD Sulfate adenylyltransferase subunit 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
O50273 2.48e-05 48 24 6 190 3 cysD Sulfate adenylyltransferase subunit 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02GZ8 2.48e-05 48 24 6 190 3 cysD Sulfate adenylyltransferase subunit 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UZY2 2.48e-05 48 24 6 190 3 cysD Sulfate adenylyltransferase subunit 2 Pseudomonas aeruginosa (strain LESB58)
A6VBB6 2.48e-05 48 24 6 190 3 cysD Sulfate adenylyltransferase subunit 2 Pseudomonas aeruginosa (strain PA7)
B5Z3B4 2.48e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X7X4 2.48e-05 48 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Escherichia coli O157:H7
Q7N8L1 2.59e-05 48 23 7 231 3 cysD Sulfate adenylyltransferase subunit 2 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q5RCH4 2.93e-05 48 30 3 103 2 FLAD1 FAD synthase Pongo abelii
P56892 3.19e-05 47 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Rhizobium meliloti (strain 1021)
B9JT86 4.27e-05 47 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
A1U490 4.71e-05 47 23 5 186 3 cysD2 Sulfate adenylyltransferase subunit 2 2 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q3KHY6 4.76e-05 47 24 6 186 3 cysD Sulfate adenylyltransferase subunit 2 Pseudomonas fluorescens (strain Pf0-1)
Q1LTP5 4.77e-05 47 22 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q1I585 5.04e-05 47 25 7 190 3 cysD Sulfate adenylyltransferase subunit 2 Pseudomonas entomophila (strain L48)
B1J166 5.08e-05 47 25 7 190 3 cysD Sulfate adenylyltransferase subunit 2 Pseudomonas putida (strain W619)
A1U3Y0 5.77e-05 47 23 5 186 3 cysD1 Sulfate adenylyltransferase subunit 2 1 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A4VIE6 6.22e-05 47 23 6 188 3 cysD Sulfate adenylyltransferase subunit 2 Stutzerimonas stutzeri (strain A1501)
A9W4X2 6.52e-05 46 22 4 190 3 cysD Sulfate adenylyltransferase subunit 2 Methylorubrum extorquens (strain PA1)
B7L0Y0 6.52e-05 46 22 4 190 3 cysD Sulfate adenylyltransferase subunit 2 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A9MF23 6.77e-05 46 22 4 186 3 cysD Sulfate adenylyltransferase subunit 2 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q88NA9 7.28e-05 46 25 7 190 3 cysD Sulfate adenylyltransferase subunit 2 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KGN7 7.28e-05 46 25 7 190 3 cysD Sulfate adenylyltransferase subunit 2 Pseudomonas putida (strain GB-1)
A5W8T2 7.28e-05 46 25 7 190 3 cysD Sulfate adenylyltransferase subunit 2 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
O33580 8.68e-05 46 24 6 186 3 cysD Sulfate adenylyltransferase subunit 2 Rhizobium tropici
Q07Y91 9.96e-05 46 24 7 190 3 cysD Sulfate adenylyltransferase subunit 2 Shewanella frigidimarina (strain NCIMB 400)
Q2SBG0 0.000111 46 23 5 190 3 cysD Sulfate adenylyltransferase subunit 2 Hahella chejuensis (strain KCTC 2396)
A1JJS9 0.000125 45 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q8R123 0.000143 46 24 7 189 1 Flad1 FAD synthase Mus musculus
A4XQP2 0.00015 45 23 6 188 3 cysD Sulfate adenylyltransferase subunit 2 Pseudomonas mendocina (strain ymp)
Q12QM9 0.000152 45 24 7 190 3 cysD Sulfate adenylyltransferase subunit 2 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A1S9N7 0.000173 45 23 5 199 3 cysD Sulfate adenylyltransferase subunit 2 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q2NVM9 0.000175 45 22 4 186 3 cysD Sulfate adenylyltransferase subunit 2 Sodalis glossinidius (strain morsitans)
A8G9Y4 0.000195 45 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Serratia proteamaculans (strain 568)
B1JJG3 0.000204 45 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EC8 0.000204 45 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TPZ2 0.000204 45 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Yersinia pestis (strain Pestoides F)
Q1CLS1 0.000204 45 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1C3 0.000204 45 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBP1 0.000204 45 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Yersinia pestis
B2K572 0.000204 45 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C483 0.000204 45 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FLY3 0.000204 45 23 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q0HYA6 0.000284 44 24 6 190 3 cysD Sulfate adenylyltransferase subunit 2 Shewanella sp. (strain MR-7)
Q0HFM4 0.000284 44 24 6 190 3 cysD Sulfate adenylyltransferase subunit 2 Shewanella sp. (strain MR-4)
A0KTI2 0.000284 44 24 6 190 3 cysD Sulfate adenylyltransferase subunit 2 Shewanella sp. (strain ANA-3)
Q8EB09 0.000297 44 24 6 190 3 cysD Sulfate adenylyltransferase subunit 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B9JB96 0.00036 44 24 6 191 3 cysD Sulfate adenylyltransferase subunit 2 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A6WJU3 0.000374 44 25 7 190 3 cysD Sulfate adenylyltransferase subunit 2 Shewanella baltica (strain OS185)
B1Z7C1 0.000421 44 22 4 190 3 cysD Sulfate adenylyltransferase subunit 2 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A8H0A3 0.000429 44 24 6 190 3 cysD Sulfate adenylyltransferase subunit 2 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TTD5 0.000429 44 24 6 190 3 cysD Sulfate adenylyltransferase subunit 2 Shewanella halifaxensis (strain HAW-EB4)
B8EE60 0.000597 43 24 7 190 3 cysD Sulfate adenylyltransferase subunit 2 Shewanella baltica (strain OS223)
A9L389 0.000613 43 24 7 190 3 cysD Sulfate adenylyltransferase subunit 2 Shewanella baltica (strain OS195)
A3D822 0.000642 43 24 7 190 3 cysD Sulfate adenylyltransferase subunit 2 Shewanella baltica (strain OS155 / ATCC BAA-1091)
A1RGF7 0.000666 43 24 7 190 3 cysD Sulfate adenylyltransferase subunit 2 Shewanella sp. (strain W3-18-1)
A4Y9X3 0.000666 43 24 7 190 3 cysD Sulfate adenylyltransferase subunit 2 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q7D0L8 0.000689 43 22 5 186 3 cysD Sulfate adenylyltransferase subunit 2 Agrobacterium fabrum (strain C58 / ATCC 33970)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS11075
Feature type CDS
Gene -
Product phosphoadenylyl-sulfate reductase
Location 2437258 - 2437989 (strand: -1)
Length 732 (nucleotides) / 243 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3905
Orthogroup size 2
N. genomes 1

Actions

Genomic region

Domains

PF01507 Phosphoadenosine phosphosulfate reductase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0175 Amino acid transport and metabolism (E)
Coenzyme transport and metabolism (H)		 EH 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase or related enzyme

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00390 phosphoadenosine phosphosulfate reductase [EC:1.8.4.8 1.8.4.10] Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments		 Assimilatory sulfate reduction, sulfate => H2S

Protein Sequence

MSRLSLSQLVLLSIEEQRLALDEINQQLEQKTAIERVIWALEHLPNQFVLSSSFGIQAAVCLHLLTRQYPDIPVILTDTGYLFPETYQFIDELTSSLQLNLKVYRAEISSSWQEARYGKLWLQGIEGIERYNQINKVAPMEKALKELQAKTWFAGLRRQQSKSREHLPVLSIAKGIFKLLPIVDWDNKQIYQYLKQHNLPYHPLWEQGYLSVGDTHTTRKWQEGMSEEETRFFGLKRECGLHE

Flanking regions ( +/- flanking 50bp)

AAACCCGTTGTTAATTCAGCCATTGATTTTTATGAAGTGCAGGAGGTGATATGAGTCGATTATCACTTTCTCAGTTGGTGTTGCTATCGATTGAAGAGCAGCGACTGGCGCTTGATGAAATCAACCAACAATTAGAGCAAAAAACGGCGATAGAGCGGGTGATTTGGGCTTTAGAACATCTTCCTAACCAGTTTGTTTTAAGCTCAAGTTTTGGTATTCAAGCGGCAGTTTGTTTGCATTTGCTCACCAGACAATATCCCGATATACCTGTAATTTTGACAGACACAGGTTATCTCTTTCCCGAAACATATCAATTTATTGATGAATTAACCTCTTCACTACAACTTAATTTAAAAGTATATCGCGCTGAAATATCTTCATCTTGGCAAGAAGCACGCTACGGCAAACTTTGGTTGCAAGGGATTGAAGGTATCGAACGTTATAACCAAATAAATAAAGTTGCGCCAATGGAAAAGGCATTAAAGGAGTTACAGGCGAAGACATGGTTTGCAGGGCTACGACGCCAGCAATCAAAAAGTCGAGAGCATTTACCTGTTTTATCCATAGCGAAAGGTATTTTTAAGTTACTACCGATAGTCGATTGGGATAATAAACAAATTTATCAATATCTTAAACAGCATAATTTACCTTACCATCCATTATGGGAACAAGGTTATCTGTCTGTGGGTGATACGCATACGACACGCAAATGGCAAGAGGGAATGAGTGAAGAAGAGACGCGATTCTTTGGCTTAAAACGTGAGTGTGGATTACACGAATAATATTATTATTCATTATTAATATCGCTATTTATTTTGAGTGGGCAATAGAG