Homologs in group_3905
1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product | |
|---|---|---|---|---|---|
| PMI_RS11075 | PMI_RS11075 | 32.7 | Proteus mirabilis HI4320 | - | phosphoadenylyl-sulfate reductase |
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| B4F231 | 0.0 | 629 | 100 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Proteus mirabilis (strain HI4320) |
| Q7N8L1 | 0.0 | 568 | 88 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) |
| Q5NRM5 | 0.0 | 551 | 86 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) |
| C6DDH0 | 0.0 | 550 | 85 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Pectobacterium carotovorum subsp. carotovorum (strain PC1) |
| Q6D1A5 | 0.0 | 549 | 85 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) |
| A1JJS9 | 0.0 | 548 | 85 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) |
| B1JJG3 | 0.0 | 548 | 84 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Yersinia pseudotuberculosis serotype O:3 (strain YPIII) |
| Q66EC8 | 0.0 | 548 | 84 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Yersinia pseudotuberculosis serotype I (strain IP32953) |
| A4TPZ2 | 0.0 | 548 | 84 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Yersinia pestis (strain Pestoides F) |
| Q1CLS1 | 0.0 | 548 | 84 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Yersinia pestis bv. Antiqua (strain Nepal516) |
| A9R1C3 | 0.0 | 548 | 84 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Yersinia pestis bv. Antiqua (strain Angola) |
| Q8ZBP1 | 0.0 | 548 | 84 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Yersinia pestis |
| B2K572 | 0.0 | 548 | 84 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Yersinia pseudotuberculosis serotype IB (strain PB1/+) |
| Q1C483 | 0.0 | 548 | 84 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Yersinia pestis bv. Antiqua (strain Antiqua) |
| A7FLY3 | 0.0 | 548 | 84 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) |
| A8G9Y4 | 0.0 | 546 | 83 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Serratia proteamaculans (strain 568) |
| A6TD44 | 0.0 | 542 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) |
| B5XV29 | 0.0 | 542 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Klebsiella pneumoniae (strain 342) |
| A4WDV7 | 0.0 | 540 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Enterobacter sp. (strain 638) |
| Q2NVM9 | 0.0 | 539 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Sodalis glossinidius (strain morsitans) |
| A8ANW6 | 0.0 | 538 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) |
| Q3YYB0 | 0.0 | 537 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Shigella sonnei (strain Ss046) |
| Q0T1I3 | 0.0 | 537 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Shigella flexneri serotype 5b (strain 8401) |
| B7LWK3 | 0.0 | 537 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) |
| Q1R7T9 | 0.0 | 537 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Escherichia coli (strain UTI89 / UPEC) |
| B1LQ73 | 0.0 | 537 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Escherichia coli (strain SMS-3-5 / SECEC) |
| B6I6E2 | 0.0 | 537 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Escherichia coli (strain SE11) |
| B7N6Y2 | 0.0 | 537 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) |
| P21156 | 0.0 | 537 | 82 | 0 | 302 | 1 | cysD | Sulfate adenylyltransferase subunit 2 | Escherichia coli (strain K12) |
| B1IUS7 | 0.0 | 537 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks) |
| Q8FEJ0 | 0.0 | 537 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
| A1AEU6 | 0.0 | 537 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Escherichia coli O1:K1 / APEC |
| B1XCS8 | 0.0 | 537 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Escherichia coli (strain K12 / DH10B) |
| C4ZZQ6 | 0.0 | 537 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Escherichia coli (strain K12 / MC4100 / BW2952) |
| B7LXG4 | 0.0 | 537 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Escherichia coli O8 (strain IAI1) |
| B7MZ53 | 0.0 | 537 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Escherichia coli O81 (strain ED1a) |
| B7NT96 | 0.0 | 537 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Escherichia coli O7:K1 (strain IAI39 / ExPEC) |
| B7LEH0 | 0.0 | 537 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Escherichia coli (strain 55989 / EAEC) |
| B7MKM6 | 0.0 | 537 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Escherichia coli O45:K1 (strain S88 / ExPEC) |
| B7UHH1 | 0.0 | 537 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Escherichia coli O127:H6 (strain E2348/69 / EPEC) |
| A7ZQJ6 | 0.0 | 537 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Escherichia coli O139:H28 (strain E24377A / ETEC) |
| P59740 | 0.0 | 537 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Shigella flexneri |
| Q31XB4 | 0.0 | 537 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Shigella boydii serotype 4 (strain Sb227) |
| B5Z3B4 | 0.0 | 537 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Escherichia coli O157:H7 (strain EC4115 / EHEC) |
| Q8X7X4 | 0.0 | 537 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Escherichia coli O157:H7 |
| A7MJ68 | 0.0 | 537 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Cronobacter sakazakii (strain ATCC BAA-894) |
| P65672 | 0.0 | 536 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
| P65673 | 0.0 | 536 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Salmonella typhi |
| A9N2D9 | 0.0 | 536 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) |
| B4T462 | 0.0 | 536 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Salmonella newport (strain SL254) |
| B4TFX2 | 0.0 | 536 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Salmonella heidelberg (strain SL476) |
| B5RDQ8 | 0.0 | 536 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Salmonella gallinarum (strain 287/91 / NCTC 13346) |
| B5QW23 | 0.0 | 536 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Salmonella enteritidis PT4 (strain P125109) |
| B5FTT0 | 0.0 | 536 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Salmonella dublin (strain CT_02021853) |
| Q57KI9 | 0.0 | 536 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Salmonella choleraesuis (strain SC-B67) |
| B5F416 | 0.0 | 536 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Salmonella agona (strain SL483) |
| Q0TEA6 | 0.0 | 536 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Escherichia coli O6:K15:H31 (strain 536 / UPEC) |
| B4TTW6 | 0.0 | 535 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Salmonella schwarzengrund (strain CVM19633) |
| B2VG02 | 0.0 | 535 | 81 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) |
| A8A3N1 | 0.0 | 535 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Escherichia coli O9:H4 (strain HS) |
| Q32CH8 | 0.0 | 535 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Shigella dysenteriae serotype 1 (strain Sd197) |
| B5BEY9 | 0.0 | 534 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Salmonella paratyphi A (strain AKU_12601) |
| Q5PEH1 | 0.0 | 534 | 82 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Salmonella paratyphi A (strain ATCC 9150 / SARB42) |
| Q1LTP5 | 0.0 | 533 | 81 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Baumannia cicadellinicola subsp. Homalodisca coagulata |
| B2TZH9 | 0.0 | 533 | 81 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) |
| A9MF23 | 0.0 | 529 | 81 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) |
| B7VKY3 | 0.0 | 525 | 78 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Vibrio atlanticus (strain LGP32) |
| Q7MPF3 | 0.0 | 525 | 79 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Vibrio vulnificus (strain YJ016) |
| Q8DE72 | 0.0 | 525 | 79 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Vibrio vulnificus (strain CMCP6) |
| Q87SY0 | 0.0 | 524 | 79 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) |
| B5FGJ8 | 0.0 | 524 | 78 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Aliivibrio fischeri (strain MJ11) |
| Q5E831 | 0.0 | 524 | 78 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Aliivibrio fischeri (strain ATCC 700601 / ES114) |
| A7MWG4 | 0.0 | 523 | 79 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Vibrio campbellii (strain ATCC BAA-1116) |
| B6ELP2 | 0.0 | 518 | 78 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Aliivibrio salmonicida (strain LFI1238) |
| C3LRM2 | 0.0 | 517 | 79 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Vibrio cholerae serotype O1 (strain M66-2) |
| Q9KP19 | 0.0 | 517 | 79 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) |
| A5F579 | 0.0 | 517 | 79 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) |
| Q6LM68 | 0.0 | 517 | 79 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Photobacterium profundum (strain SS9) |
| A0KP36 | 0.0 | 513 | 78 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) |
| B0TTD5 | 0.0 | 510 | 78 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Shewanella halifaxensis (strain HAW-EB4) |
| A8H0A3 | 0.0 | 508 | 78 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) |
| B8CSV0 | 0.0 | 508 | 77 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Shewanella piezotolerans (strain WP3 / JCM 13877) |
| A4SRG9 | 0.0 | 508 | 79 | 0 | 298 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Aeromonas salmonicida (strain A449) |
| Q3ILR0 | 0.0 | 504 | 78 | 0 | 297 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Pseudoalteromonas translucida (strain TAC 125) |
| Q0HYA6 | 0.0 | 503 | 77 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Shewanella sp. (strain MR-7) |
| Q0HFM4 | 0.0 | 503 | 77 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Shewanella sp. (strain MR-4) |
| A0KTI2 | 0.0 | 503 | 77 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Shewanella sp. (strain ANA-3) |
| Q8EB09 | 1.63e-180 | 502 | 77 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1) |
| Q6FDA0 | 2.2e-180 | 502 | 77 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) |
| B0V9N5 | 4.26e-180 | 501 | 77 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Acinetobacter baumannii (strain AYE) |
| B0VSD7 | 4.26e-180 | 501 | 77 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Acinetobacter baumannii (strain SDF) |
| A1S9N7 | 5.09e-180 | 501 | 77 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) |
| A3QCU1 | 1.68e-179 | 499 | 76 | 0 | 299 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Shewanella loihica (strain ATCC BAA-1088 / PV-4) |
| A1ST25 | 1.75e-178 | 497 | 75 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37) |
| A1RGF7 | 2.05e-178 | 497 | 77 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Shewanella sp. (strain W3-18-1) |
| A4Y9X3 | 2.05e-178 | 497 | 77 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) |
| A9L389 | 2.6e-178 | 497 | 77 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Shewanella baltica (strain OS195) |
| A3D822 | 1.01e-177 | 495 | 76 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Shewanella baltica (strain OS155 / ATCC BAA-1091) |
| A6WJU3 | 1.41e-177 | 495 | 76 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Shewanella baltica (strain OS185) |
| B8EE60 | 1.41e-177 | 495 | 76 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Shewanella baltica (strain OS223) |
| Q12QM9 | 5.07e-177 | 493 | 76 | 0 | 297 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) |
| Q07Y91 | 8.13e-177 | 493 | 76 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Shewanella frigidimarina (strain NCIMB 400) |
| Q604B7 | 3.49e-175 | 489 | 76 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) |
| Q30U93 | 5.42e-175 | 488 | 74 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) |
| A8FXJ5 | 5.57e-175 | 488 | 74 | 0 | 298 | 3 | cysD1 | Sulfate adenylyltransferase subunit 2 1 | Shewanella sediminis (strain HAW-EB3) |
| A1U490 | 5.69e-175 | 488 | 75 | 0 | 302 | 3 | cysD2 | Sulfate adenylyltransferase subunit 2 2 | Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8) |
| A8FXM2 | 5.82e-175 | 488 | 75 | 0 | 296 | 3 | cysD2 | Sulfate adenylyltransferase subunit 2 2 | Shewanella sediminis (strain HAW-EB3) |
| Q2SBG0 | 1.24e-174 | 488 | 75 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Hahella chejuensis (strain KCTC 2396) |
| A6VXC5 | 1.68e-174 | 487 | 74 | 1 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Marinomonas sp. (strain MWYL1) |
| B1KMH3 | 5.21e-174 | 486 | 74 | 0 | 299 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Shewanella woodyi (strain ATCC 51908 / MS32) |
| Q21IS4 | 3.2e-173 | 484 | 73 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) |
| A1U3Y0 | 6.47e-173 | 483 | 76 | 0 | 296 | 3 | cysD1 | Sulfate adenylyltransferase subunit 2 1 | Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8) |
| Q3A3P5 | 3.42e-172 | 481 | 74 | 0 | 300 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1) |
| Q0A653 | 8.81e-172 | 480 | 75 | 0 | 302 | 3 | cysD2 | Sulfate adenylyltransferase subunit 2 2 | Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) |
| Q483A0 | 4.72e-171 | 478 | 72 | 0 | 298 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Colwellia psychrerythraea (strain 34H / ATCC BAA-681) |
| C3KDP1 | 1.73e-170 | 477 | 74 | 1 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Pseudomonas fluorescens (strain SBW25) |
| C1DQ71 | 1.79e-170 | 477 | 75 | 2 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Azotobacter vinelandii (strain DJ / ATCC BAA-1303) |
| O50273 | 4.31e-170 | 476 | 74 | 2 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) |
| Q02GZ8 | 4.31e-170 | 476 | 74 | 2 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Pseudomonas aeruginosa (strain UCBPP-PA14) |
| B7UZY2 | 4.31e-170 | 476 | 74 | 2 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Pseudomonas aeruginosa (strain LESB58) |
| A6VBB6 | 4.31e-170 | 476 | 74 | 2 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Pseudomonas aeruginosa (strain PA7) |
| Q88NA9 | 7.87e-170 | 475 | 73 | 1 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) |
| B0KGN7 | 7.87e-170 | 475 | 73 | 1 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Pseudomonas putida (strain GB-1) |
| A5W8T2 | 7.87e-170 | 475 | 73 | 1 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1) |
| Q4KI67 | 9.37e-170 | 475 | 73 | 2 | 303 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) |
| B1J166 | 9.9e-170 | 475 | 73 | 1 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Pseudomonas putida (strain W619) |
| Q48ED3 | 3.23e-169 | 474 | 73 | 2 | 303 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) |
| Q7NVN6 | 3.45e-169 | 474 | 73 | 2 | 308 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK) |
| Q1I585 | 5.01e-169 | 473 | 73 | 2 | 303 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Pseudomonas entomophila (strain L48) |
| Q3KHY6 | 8.38e-169 | 473 | 73 | 1 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Pseudomonas fluorescens (strain Pf0-1) |
| Q4ZNW4 | 1.29e-168 | 472 | 73 | 2 | 303 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Pseudomonas syringae pv. syringae (strain B728a) |
| Q87WW0 | 1.29e-168 | 472 | 73 | 2 | 303 | 1 | cysD | Sulfate adenylyltransferase subunit 2 | Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) |
| A8EWR5 | 1.22e-167 | 470 | 73 | 0 | 298 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Aliarcobacter butzleri (strain RM4018) |
| Q15VB5 | 1.78e-167 | 469 | 73 | 0 | 298 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) |
| B0T3J3 | 2.42e-167 | 469 | 72 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Caulobacter sp. (strain K31) |
| Q9A881 | 5.43e-167 | 468 | 72 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15) |
| A1WZK4 | 3e-166 | 466 | 71 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Halorhodospira halophila (strain DSM 244 / SL1) |
| A4VIE6 | 2.41e-165 | 464 | 72 | 2 | 304 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Stutzerimonas stutzeri (strain A1501) |
| Q1QWX0 | 5.49e-165 | 463 | 73 | 0 | 296 | 3 | cysD1 | Sulfate adenylyltransferase subunit 2 1 | Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) |
| A4XQP2 | 5.67e-165 | 463 | 72 | 2 | 304 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Pseudomonas mendocina (strain ymp) |
| Q0A977 | 2.35e-164 | 462 | 73 | 0 | 296 | 3 | cysD1 | Sulfate adenylyltransferase subunit 2 1 | Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) |
| Q1QUF8 | 3.43e-164 | 461 | 73 | 0 | 296 | 3 | cysD2 | Sulfate adenylyltransferase subunit 2 2 | Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) |
| B3E8X9 | 2.2e-163 | 459 | 72 | 0 | 297 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) |
| Q39RP7 | 4.19e-163 | 458 | 75 | 0 | 299 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) |
| A6QB13 | 6.33e-163 | 458 | 71 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Sulfurovum sp. (strain NBC37-1) |
| B9M197 | 4.82e-162 | 456 | 76 | 0 | 297 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32) |
| A5G8G3 | 6.34e-162 | 455 | 75 | 1 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Geotalea uraniireducens (strain Rf4) |
| B8D7V4 | 2.03e-161 | 454 | 69 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) |
| P57499 | 2.03e-161 | 454 | 69 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) |
| B8D9K2 | 2.03e-161 | 454 | 69 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) |
| C6E751 | 2.78e-161 | 454 | 75 | 0 | 299 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Geobacter sp. (strain M21) |
| B5EF56 | 3.35e-161 | 453 | 75 | 0 | 299 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem) |
| Q39EM7 | 3.59e-161 | 453 | 73 | 0 | 297 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383) |
| Q985Q5 | 3.72e-159 | 448 | 71 | 0 | 297 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) |
| Q5YUA1 | 7.25e-159 | 448 | 71 | 0 | 297 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Nocardia farcinica (strain IFM 10152) |
| Q11K42 | 4.52e-158 | 446 | 71 | 0 | 299 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Chelativorans sp. (strain BNC1) |
| A6KXG8 | 6.53e-158 | 445 | 70 | 0 | 298 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) |
| P72338 | 6.63e-158 | 445 | 71 | 0 | 297 | 3 | nodP | Sulfate adenylyltransferase subunit 2 | Rhizobium sp. (strain N33) |
| A6LA51 | 4.62e-157 | 443 | 68 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) |
| Q64VR0 | 9.76e-157 | 442 | 68 | 0 | 300 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Bacteroides fragilis (strain YCH46) |
| Q5LES4 | 9.76e-157 | 442 | 68 | 0 | 300 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2) |
| Q07UU1 | 3.27e-156 | 442 | 69 | 0 | 296 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Rhodopseudomonas palustris (strain BisA53) |
| Q8AAQ0 | 1e-154 | 437 | 67 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) |
| Q57FI5 | 6.75e-154 | 435 | 72 | 0 | 298 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Brucella abortus biovar 1 (strain 9-941) |
| Q2YP46 | 6.75e-154 | 435 | 72 | 0 | 298 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Brucella abortus (strain 2308) |
| Q21D94 | 1.53e-153 | 435 | 69 | 0 | 296 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Rhodopseudomonas palustris (strain BisB18) |
| Q8G2W6 | 2.16e-153 | 434 | 72 | 0 | 298 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Brucella suis biovar 1 (strain 1330) |
| B0CJ51 | 2.16e-153 | 434 | 72 | 0 | 298 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Brucella suis (strain ATCC 23445 / NCTC 10510) |
| A5VNC5 | 2.16e-153 | 434 | 72 | 0 | 298 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) |
| A9M7D7 | 2.16e-153 | 434 | 72 | 0 | 298 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666) |
| A5E8X6 | 8.99e-153 | 433 | 69 | 0 | 297 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) |
| P56892 | 1.06e-152 | 432 | 69 | 0 | 295 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Rhizobium meliloti (strain 1021) |
| Q8YEX2 | 1.67e-152 | 431 | 72 | 0 | 298 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M) |
| C0RGP5 | 1.67e-152 | 431 | 72 | 0 | 298 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Brucella melitensis biotype 2 (strain ATCC 23457) |
| Q0C438 | 3.01e-152 | 432 | 68 | 0 | 297 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Hyphomonas neptunium (strain ATCC 15444) |
| O33580 | 3.37e-152 | 431 | 69 | 0 | 295 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Rhizobium tropici |
| Q7D0L8 | 1.82e-151 | 429 | 68 | 0 | 295 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Agrobacterium fabrum (strain C58 / ATCC 33970) |
| Q2RS06 | 1.94e-151 | 429 | 67 | 1 | 297 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1) |
| B5ZUF6 | 2.67e-151 | 429 | 69 | 0 | 295 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Rhizobium leguminosarum bv. trifolii (strain WSM2304) |
| Q8P610 | 2.8e-151 | 428 | 67 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) |
| B0RPG8 | 2.8e-151 | 428 | 67 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Xanthomonas campestris pv. campestris (strain B100) |
| Q4UY06 | 2.8e-151 | 428 | 67 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Xanthomonas campestris pv. campestris (strain 8004) |
| P13441 | 3.03e-151 | 428 | 66 | 0 | 297 | 3 | nodP | Sulfate adenylyltransferase subunit 2 | Rhizobium meliloti (strain 1021) |
| Q3BPY6 | 4.06e-151 | 428 | 67 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10) |
| B9JB96 | 4.82e-151 | 428 | 69 | 0 | 295 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Rhizobium rhizogenes (strain K84 / ATCC BAA-868) |
| B2SI03 | 7.26e-151 | 427 | 67 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Xanthomonas oryzae pv. oryzae (strain PXO99A) |
| Q2P0H4 | 7.26e-151 | 427 | 67 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Xanthomonas oryzae pv. oryzae (strain MAFF 311018) |
| B9JT86 | 1.49e-150 | 427 | 67 | 0 | 295 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4) |
| A6WVC7 | 1.69e-150 | 426 | 70 | 0 | 298 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) |
| Q0ALV0 | 4.95e-150 | 425 | 67 | 0 | 296 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Maricaulis maris (strain MCS10) |
| Q8PHD0 | 6.7e-150 | 425 | 67 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Xanthomonas axonopodis pv. citri (strain 306) |
| B8IRX8 | 8.85e-150 | 425 | 67 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060) |
| Q1MJV3 | 1.91e-149 | 424 | 69 | 0 | 295 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841) |
| B3PTD3 | 4.53e-149 | 423 | 69 | 0 | 295 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Rhizobium etli (strain CIAT 652) |
| B0U8Y5 | 6.26e-149 | 423 | 67 | 0 | 298 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Methylobacterium sp. (strain 4-46) |
| A4SDU0 | 1.29e-148 | 422 | 66 | 0 | 302 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Chlorobium phaeovibrioides (strain DSM 265 / 1930) |
| Q2KB48 | 1.35e-148 | 422 | 68 | 0 | 295 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42) |
| A0L6E2 | 2.1e-148 | 421 | 68 | 0 | 299 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) |
| B1LSA1 | 2.48e-148 | 421 | 67 | 0 | 298 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1) |
| B1Z7C1 | 3.33e-148 | 421 | 67 | 0 | 299 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) |
| A9W4X2 | 9.2e-148 | 420 | 67 | 0 | 299 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Methylorubrum extorquens (strain PA1) |
| B7L0Y0 | 9.2e-148 | 420 | 67 | 0 | 299 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Methylorubrum extorquens (strain CM4 / NCIMB 13688) |
| Q1D9W6 | 9.62e-148 | 419 | 65 | 0 | 296 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Myxococcus xanthus (strain DK1622) |
| Q9PD79 | 4.85e-147 | 417 | 67 | 0 | 298 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Xylella fastidiosa (strain 9a5c) |
| A4YYA7 | 1.47e-146 | 417 | 66 | 1 | 303 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Bradyrhizobium sp. (strain ORS 278) |
| B2URN8 | 8.99e-146 | 414 | 65 | 0 | 298 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) |
| P28603 | 2.91e-142 | 405 | 64 | 0 | 294 | 3 | nodP | Sulfate adenylyltransferase subunit 2 | Azospirillum brasilense |
| Q87DG8 | 4.89e-139 | 397 | 67 | 0 | 297 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Xylella fastidiosa (strain Temecula1 / ATCC 700964) |
| O07308 | 2.32e-137 | 393 | 64 | 0 | 297 | 3 | nodP | Sulfate adenylyltransferase subunit 2 | Rhizobium sp. (strain BR816) |
| P52995 | 3.69e-128 | 370 | 60 | 0 | 295 | 3 | nodP | Sulfate adenylyltransferase subunit 2 | Rhizobium tropici |
| A1TDE9 | 3.53e-94 | 284 | 50 | 3 | 299 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1) |
| A4T8Q2 | 6.43e-94 | 283 | 50 | 3 | 299 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Mycolicibacterium gilvum (strain PYR-GCK) |
| A3Q3I2 | 3.94e-92 | 278 | 50 | 3 | 299 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Mycobacterium sp. (strain JLS) |
| Q1B510 | 4.58e-92 | 278 | 50 | 3 | 299 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Mycobacterium sp. (strain MCS) |
| A1UK27 | 4.58e-92 | 278 | 50 | 3 | 299 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Mycobacterium sp. (strain KMS) |
| P9WIK1 | 1.47e-91 | 277 | 49 | 3 | 299 | 1 | cysD | Sulfate adenylyltransferase subunit 2 | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| P9WIK0 | 1.47e-91 | 277 | 49 | 3 | 299 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| A5U1Y3 | 1.47e-91 | 277 | 49 | 3 | 299 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) |
| A1KI72 | 1.47e-91 | 277 | 49 | 3 | 299 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Mycobacterium bovis (strain BCG / Pasteur 1173P2) |
| P65671 | 1.47e-91 | 277 | 49 | 3 | 299 | 3 | cysD | Sulfate adenylyltransferase subunit 2 | Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) |
| Q9X5U0 | 6.63e-81 | 250 | 45 | 5 | 304 | 3 | mmcV | Sulfate adenylyltransferase subunit 2 | Streptomyces lavendulae |
| Q9PD82 | 2.1e-13 | 71 | 26 | 6 | 218 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Xylella fastidiosa (strain 9a5c) |
| B0U6V9 | 2.27e-13 | 71 | 26 | 6 | 218 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Xylella fastidiosa (strain M12) |
| Q87DH1 | 2.83e-12 | 68 | 26 | 6 | 218 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Xylella fastidiosa (strain Temecula1 / ATCC 700964) |
| B2IA30 | 2.83e-12 | 68 | 26 | 6 | 218 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Xylella fastidiosa (strain M23) |
| Q3BPY3 | 6.69e-12 | 67 | 24 | 4 | 190 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10) |
| Q0A6T1 | 7.1e-12 | 67 | 24 | 3 | 186 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) |
| Q8PHC7 | 2.08e-11 | 66 | 24 | 4 | 190 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Xanthomonas axonopodis pv. citri (strain 306) |
| B7VI86 | 2.55e-11 | 66 | 26 | 8 | 258 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Vibrio atlanticus (strain LGP32) |
| B2SI06 | 2.62e-11 | 65 | 24 | 4 | 190 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Xanthomonas oryzae pv. oryzae (strain PXO99A) |
| Q2P0H1 | 2.62e-11 | 65 | 24 | 4 | 190 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Xanthomonas oryzae pv. oryzae (strain MAFF 311018) |
| Q87L92 | 3.98e-11 | 65 | 28 | 4 | 182 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) |
| Q8CWK6 | 7.05e-11 | 64 | 33 | 3 | 133 | 1 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Vibrio vulnificus (strain CMCP6) |
| Q7MHA7 | 1.11e-10 | 64 | 33 | 3 | 133 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Vibrio vulnificus (strain YJ016) |
| C3LRB8 | 1.26e-10 | 63 | 30 | 3 | 139 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Vibrio cholerae serotype O1 (strain M66-2) |
| Q9KUX2 | 1.26e-10 | 63 | 30 | 3 | 139 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) |
| A5F3I6 | 1.26e-10 | 63 | 30 | 3 | 139 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) |
| Q8P607 | 1.65e-10 | 63 | 24 | 4 | 183 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) |
| B0RPG5 | 1.65e-10 | 63 | 24 | 4 | 183 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Xanthomonas campestris pv. campestris (strain B100) |
| Q4UY09 | 1.65e-10 | 63 | 24 | 4 | 183 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Xanthomonas campestris pv. campestris (strain 8004) |
| B8D7V6 | 4.11e-10 | 62 | 29 | 6 | 186 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) |
| A7MSZ6 | 4.71e-10 | 62 | 28 | 7 | 210 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Vibrio campbellii (strain ATCC BAA-1116) |
| A1JJS4 | 1.1e-09 | 61 | 25 | 7 | 212 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) |
| P57501 | 1.65e-09 | 60 | 29 | 6 | 186 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) |
| B8D9K4 | 1.7e-09 | 60 | 29 | 6 | 186 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) |
| A4WDV9 | 1.77e-09 | 60 | 25 | 6 | 210 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Enterobacter sp. (strain 638) |
| A8ANW8 | 2.16e-09 | 60 | 24 | 5 | 207 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) |
| A7MJ65 | 2.71e-09 | 60 | 25 | 6 | 204 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Cronobacter sakazakii (strain ATCC BAA-894) |
| Q1R7T6 | 5.21e-09 | 59 | 25 | 6 | 212 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Escherichia coli (strain UTI89 / UPEC) |
| A1AEU8 | 5.21e-09 | 59 | 25 | 6 | 212 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Escherichia coli O1:K1 / APEC |
| B7MYR0 | 5.21e-09 | 59 | 25 | 6 | 212 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Escherichia coli O81 (strain ED1a) |
| B7MKM9 | 5.21e-09 | 59 | 25 | 6 | 212 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Escherichia coli O45:K1 (strain S88 / ExPEC) |
| Q7UBT0 | 5.63e-09 | 59 | 25 | 7 | 210 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Shigella flexneri |
| B1LQ85 | 5.63e-09 | 59 | 25 | 7 | 210 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Escherichia coli (strain SMS-3-5 / SECEC) |
| B7NT99 | 5.63e-09 | 59 | 25 | 7 | 210 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Escherichia coli O7:K1 (strain IAI39 / ExPEC) |
| B6I6F6 | 5.79e-09 | 58 | 25 | 7 | 210 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Escherichia coli (strain SE11) |
| B7LXH5 | 5.79e-09 | 58 | 25 | 7 | 210 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Escherichia coli O8 (strain IAI1) |
| B7LEI1 | 5.79e-09 | 58 | 25 | 7 | 210 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Escherichia coli (strain 55989 / EAEC) |
| A7ZQK5 | 5.79e-09 | 58 | 25 | 7 | 210 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Escherichia coli O139:H28 (strain E24377A / ETEC) |
| Q0T1I6 | 6.01e-09 | 58 | 25 | 7 | 210 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Shigella flexneri serotype 5b (strain 8401) |
| B5Z3C5 | 6.36e-09 | 58 | 25 | 6 | 212 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Escherichia coli O157:H7 (strain EC4115 / EHEC) |
| Q8X7U3 | 6.36e-09 | 58 | 25 | 6 | 212 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Escherichia coli O157:H7 |
| Q8FEI9 | 7.06e-09 | 58 | 25 | 6 | 212 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
| Q0TEA4 | 7.06e-09 | 58 | 25 | 6 | 212 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Escherichia coli O6:K15:H31 (strain 536 / UPEC) |
| B7UHH4 | 7.06e-09 | 58 | 25 | 6 | 212 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Escherichia coli O127:H6 (strain E2348/69 / EPEC) |
| A8G9X8 | 8.14e-09 | 58 | 25 | 7 | 211 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Serratia proteamaculans (strain 568) |
| B7LWP0 | 8.29e-09 | 58 | 25 | 6 | 210 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) |
| B7N6Z6 | 8.29e-09 | 58 | 25 | 6 | 210 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) |
| P17854 | 8.29e-09 | 58 | 25 | 6 | 210 | 1 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Escherichia coli (strain K12) |
| B1IUR7 | 8.29e-09 | 58 | 25 | 6 | 210 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks) |
| B1XDH5 | 8.29e-09 | 58 | 25 | 6 | 210 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Escherichia coli (strain K12 / DH10B) |
| C4ZZR6 | 8.29e-09 | 58 | 25 | 6 | 210 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Escherichia coli (strain K12 / MC4100 / BW2952) |
| Q3YY96 | 8.78e-09 | 58 | 25 | 6 | 210 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Shigella sonnei (strain Ss046) |
| Q31XM6 | 8.78e-09 | 58 | 25 | 6 | 210 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Shigella boydii serotype 4 (strain Sb227) |
| B2TZH2 | 8.78e-09 | 58 | 25 | 6 | 210 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) |
| A8A3P3 | 8.78e-09 | 58 | 25 | 6 | 210 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Escherichia coli O9:H4 (strain HS) |
| B4TTX7 | 9.29e-09 | 58 | 25 | 8 | 212 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Salmonella schwarzengrund (strain CVM19633) |
| Q6LM60 | 9.64e-09 | 58 | 26 | 6 | 219 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Photobacterium profundum (strain SS9) |
| Q32CG5 | 9.74e-09 | 58 | 25 | 7 | 212 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Shigella dysenteriae serotype 1 (strain Sd197) |
| B4F233 | 1.85e-08 | 57 | 25 | 9 | 249 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Proteus mirabilis (strain HI4320) |
| B4T473 | 3.05e-08 | 57 | 25 | 8 | 212 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Salmonella newport (strain SL254) |
| Q5E839 | 3.37e-08 | 57 | 28 | 3 | 139 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Aliivibrio fischeri (strain ATCC 700601 / ES114) |
| A6TD47 | 4.12e-08 | 56 | 23 | 4 | 188 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) |
| Q5NRM3 | 8.83e-08 | 55 | 32 | 3 | 121 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) |
| B5FGJ0 | 8.84e-08 | 55 | 28 | 3 | 139 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Aliivibrio fischeri (strain MJ11) |
| P17853 | 1.05e-07 | 55 | 25 | 8 | 212 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
| Q8Z460 | 1.32e-07 | 55 | 25 | 6 | 186 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Salmonella typhi |
| B5XV26 | 1.37e-07 | 55 | 24 | 4 | 182 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Klebsiella pneumoniae (strain 342) |
| P52672 | 1.38e-07 | 55 | 28 | 4 | 138 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Thiocapsa roseopersicina |
| Q57KH9 | 1.56e-07 | 54 | 25 | 8 | 212 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Salmonella choleraesuis (strain SC-B67) |
| Q8EB01 | 1.67e-07 | 54 | 21 | 7 | 228 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1) |
| B5BEZ7 | 1.73e-07 | 54 | 25 | 6 | 186 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Salmonella paratyphi A (strain AKU_12601) |
| Q5PEH9 | 1.73e-07 | 54 | 25 | 6 | 186 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Salmonella paratyphi A (strain ATCC 9150 / SARB42) |
| C5D5A7 | 2e-07 | 54 | 27 | 5 | 175 | 3 | cysH | Adenosine 5'-phosphosulfate reductase | Geobacillus sp. (strain WCH70) |
| Q11B66 | 2.09e-07 | 54 | 25 | 4 | 181 | 3 | cysH | Adenosine 5'-phosphosulfate reductase | Chelativorans sp. (strain BNC1) |
| O06737 | 2.1e-07 | 54 | 28 | 7 | 196 | 3 | cysH1 | Adenosine 5'-phosphosulfate reductase 2 | Bacillus subtilis (strain 168) |
| B4TFY3 | 2.15e-07 | 54 | 25 | 6 | 186 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Salmonella heidelberg (strain SL476) |
| B5F429 | 2.17e-07 | 54 | 25 | 8 | 212 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Salmonella agona (strain SL483) |
| A9N2E4 | 2.36e-07 | 54 | 25 | 8 | 212 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) |
| B5RDR9 | 2.36e-07 | 54 | 25 | 8 | 212 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Salmonella gallinarum (strain 287/91 / NCTC 13346) |
| B5QW34 | 2.36e-07 | 54 | 25 | 8 | 212 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Salmonella enteritidis PT4 (strain P125109) |
| B5FTU1 | 2.36e-07 | 54 | 25 | 8 | 212 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Salmonella dublin (strain CT_02021853) |
| B2VG05 | 2.67e-07 | 54 | 24 | 5 | 186 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) |
| A9MF18 | 3.4e-07 | 53 | 23 | 4 | 186 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) |
| B4RYS5 | 1.1e-06 | 52 | 23 | 4 | 182 | 3 | cysH1 | Phosphoadenosine 5'-phosphosulfate reductase | Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype) |
| Q58383 | 1.23e-06 | 53 | 27 | 6 | 211 | 3 | MJ0973 | Uncharacterized protein MJ0973 | Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) |
| Q7MB85 | 1.4e-06 | 52 | 24 | 8 | 199 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) |
| Q2NVN2 | 1.79e-06 | 51 | 22 | 5 | 189 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Sodalis glossinidius (strain morsitans) |
| B1JJG7 | 2.41e-06 | 51 | 24 | 8 | 212 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Yersinia pseudotuberculosis serotype O:3 (strain YPIII) |
| Q66ED2 | 2.41e-06 | 51 | 24 | 8 | 212 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Yersinia pseudotuberculosis serotype I (strain IP32953) |
| B2K567 | 2.41e-06 | 51 | 24 | 8 | 212 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Yersinia pseudotuberculosis serotype IB (strain PB1/+) |
| A7FLY8 | 2.41e-06 | 51 | 24 | 8 | 212 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) |
| P72794 | 3.27e-06 | 50 | 22 | 4 | 187 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa) |
| Q1LTP3 | 4.64e-06 | 50 | 31 | 4 | 122 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Baumannia cicadellinicola subsp. Homalodisca coagulata |
| B6ELM6 | 6.97e-06 | 50 | 26 | 6 | 185 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Aliivibrio salmonicida (strain LFI1238) |
| C1EMR8 | 1.47e-05 | 48 | 23 | 8 | 242 | 3 | cysH | Adenosine 5'-phosphosulfate reductase | Bacillus cereus (strain 03BB102) |
| Q5N1N0 | 1.68e-05 | 48 | 23 | 6 | 201 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) |
| Q55309 | 1.68e-05 | 48 | 23 | 6 | 201 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805) |
| B7HKE5 | 2.05e-05 | 48 | 23 | 8 | 241 | 3 | cysH | Adenosine 5'-phosphosulfate reductase | Bacillus cereus (strain AH187) |
| Q6HLD4 | 2.19e-05 | 48 | 23 | 8 | 241 | 3 | cysH | Adenosine 5'-phosphosulfate reductase | Bacillus thuringiensis subsp. konkukian (strain 97-27) |
| B1XN08 | 2.61e-05 | 48 | 21 | 6 | 210 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) |
| A8FD22 | 4.78e-05 | 47 | 26 | 6 | 186 | 3 | cysH | Adenosine 5'-phosphosulfate reductase | Bacillus pumilus (strain SAFR-032) |
| C6DDH2 | 5.15e-05 | 47 | 26 | 2 | 121 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Pectobacterium carotovorum subsp. carotovorum (strain PC1) |
| D3RNJ4 | 6.29e-05 | 47 | 24 | 9 | 212 | 3 | cysH | Adenosine 5'-phosphosulfate reductase | Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) |
| Q6D1A3 | 7.3e-05 | 47 | 20 | 7 | 251 | 3 | cysH | Phosphoadenosine 5'-phosphosulfate reductase | Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) |
| P94498 | 9.38e-05 | 46 | 25 | 6 | 186 | 1 | cysH | Adenosine 5'-phosphosulfate reductase 1 | Bacillus subtilis (strain 168) |
| B9IV11 | 0.000111 | 46 | 23 | 7 | 226 | 3 | cysH | Adenosine 5'-phosphosulfate reductase | Bacillus cereus (strain Q1) |
| Q5WKF5 | 0.000118 | 46 | 24 | 7 | 210 | 3 | cysH | Adenosine 5'-phosphosulfate reductase | Shouchella clausii (strain KSM-K16) |
| Q63DV9 | 0.00012 | 46 | 22 | 8 | 241 | 3 | cysH | Adenosine 5'-phosphosulfate reductase | Bacillus cereus (strain ZK / E33L) |
| B1HXC6 | 0.000232 | 45 | 23 | 6 | 201 | 3 | cysH | Adenosine 5'-phosphosulfate reductase | Lysinibacillus sphaericus (strain C3-41) |
| A7Z4H7 | 0.000311 | 45 | 27 | 6 | 181 | 3 | cysH | Adenosine 5'-phosphosulfate reductase | Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42) |
| B7HHH6 | 0.000425 | 44 | 22 | 8 | 242 | 3 | cysH | Adenosine 5'-phosphosulfate reductase | Bacillus cereus (strain B4264) |
| A4IKB7 | 0.000451 | 44 | 24 | 4 | 175 | 3 | cysH | Adenosine 5'-phosphosulfate reductase | Geobacillus thermodenitrificans (strain NG80-2) |
| A0RBN2 | 0.000529 | 44 | 23 | 7 | 226 | 3 | cysH | Adenosine 5'-phosphosulfate reductase | Bacillus thuringiensis (strain Al Hakam) |
| Q81FZ1 | 0.00071 | 43 | 22 | 8 | 242 | 3 | cysH | Adenosine 5'-phosphosulfate reductase | Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) |
| B7JG06 | 0.000801 | 43 | 23 | 7 | 226 | 3 | cysH | Adenosine 5'-phosphosulfate reductase | Bacillus cereus (strain AH820) |
| Q73B76 | 0.001 | 43 | 23 | 7 | 226 | 3 | cysH | Adenosine 5'-phosphosulfate reductase | Bacillus cereus (strain ATCC 10987 / NRS 248) |
| Source | Proteus mirabilis HI4320 |
|---|---|
| Locus tag | PMI_RS11065 |
| Feature type | CDS |
| Gene | cysD |
| Product | sulfate adenylyltransferase subunit CysD |
| Location | 2434696 - 2435604 (strand: -1) |
| Length | 909 (nucleotides) / 302 (amino acids) |
| Accession | NC_010554 |
|---|---|
| Length | 4063606 nucleotides |
| Topology | circular |
| Plasmid | False |
| Orthogroup | group_3905 | |
|---|---|---|
| Orthogroup size | 2 | |
| N. genomes | 1 |
| PF01507 | Phosphoadenosine phosphosulfate reductase family |
|---|
| ID | Function(s) descr. | Function(s) cat. | Description |
|---|---|---|---|
| COG0175 | Amino acid transport and metabolism (E) Coenzyme transport and metabolism (H) |
EH | 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase or related enzyme |
| KO | Description | Pathways | Modules |
|---|---|---|---|
| K00957 | sulfate adenylyltransferase subunit 2 [EC:2.7.7.4] | Purine metabolism Monobactam biosynthesis Selenocompound metabolism Sulfur metabolism Metabolic pathways Biosynthesis of secondary metabolites Microbial metabolism in diverse environments |
Assimilatory sulfate reduction, sulfate => H2S |
MNETQLTHLQQLEAESIYILREVVAEFENPVMLYSIGKDSSVMLHLARKAFYPAKLPFPLLHVDTGWKFREMYEFRDKTAKEYGFDLKVYRNPQGAQLGINPFIHGSAKHTDIMKTEGLKQALDKYGFDAAFGGARRDEEKSRAKERIYSFRDRSHRWDPKNQRPELWQNYNGQINKGESIRVFPLSNWTELDIWQYIYLENIDIVPLYFAKHRPVIERDGTLIMVDDDRIDLKAGEVITQQKVRFRTLGCWPLTGAIPSQADTLPAIIEEMLISTSSERQGRLIDSDQSASMELKKRQGYF
ACCTCTGCCATCCACTCATCTTTGGTTCATTTTGCCTAAACGAGGTTGTTATGAATGAAACACAATTAACCCATCTTCAGCAATTAGAAGCAGAAAGCATTTATATACTGCGTGAAGTTGTCGCTGAATTTGAAAATCCCGTCATGCTTTACTCAATAGGCAAAGATTCTTCGGTGATGTTGCATCTAGCACGTAAGGCTTTTTATCCGGCGAAATTACCTTTTCCTCTTTTACATGTTGATACGGGTTGGAAATTTCGTGAGATGTATGAGTTTCGCGATAAAACGGCCAAAGAGTATGGTTTTGATCTCAAAGTTTATCGTAATCCCCAAGGGGCACAATTGGGGATCAATCCCTTTATTCATGGTAGCGCCAAGCATACAGATATCATGAAAACAGAAGGTCTTAAGCAAGCTCTGGATAAATATGGTTTTGATGCCGCATTTGGTGGGGCGCGTCGTGATGAAGAAAAATCGCGTGCTAAAGAGCGTATTTACTCATTTAGAGATAGATCTCATCGTTGGGATCCGAAAAATCAACGTCCAGAATTATGGCAAAACTACAACGGCCAAATTAATAAAGGGGAAAGTATTCGCGTTTTTCCATTATCAAATTGGACGGAGCTAGATATTTGGCAATATATCTATTTAGAAAATATCGATATTGTGCCGCTCTATTTCGCTAAACACCGTCCAGTCATTGAGCGGGATGGTACCTTGATTATGGTTGACGATGATCGAATCGACCTAAAAGCTGGAGAGGTGATCACACAACAAAAAGTACGCTTTAGAACATTAGGCTGCTGGCCATTAACGGGTGCTATTCCTTCACAAGCAGACACATTACCCGCCATTATTGAAGAGATGTTAATTTCCACCAGTAGCGAGCGACAAGGGCGTTTAATTGACAGTGATCAGTCTGCTTCAATGGAACTTAAAAAACGTCAGGGTTATTTTTAATAGGAGTCACTATGGGACTTGCAGCCATCAAAACCAACCAACTGATCGCC
