Homologs in group_4518

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4518

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4518

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P04132 1.33e-26 97 45 0 99 1 C Repressor protein C Escherichia phage P2

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS09890
Feature type CDS
Gene -
Product helix-turn-helix transcriptional regulator
Location 2145633 - 2145932 (strand: 1)
Length 300 (nucleotides) / 99 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_4518
Orthogroup size 1
N. genomes 1

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1476 Transcription (K) K DNA-binding transcriptional regulator, XRE-family HTH domain

Protein Sequence

MSSSKNEKLKLIRESERLKLKEMSDLTGINYHTYHGYESGKMNMSLEAATKLFSIPRFRKYMTWFMFDEINPDAGQIAPALAHSGQDNTQSSHSDKKIG

Flanking regions ( +/- flanking 50bp)

CTATACGTGGGTGTTTCGTATTAAATAAAATTTAGAGGATCCGCAAAATTATGTCAAGTTCGAAAAATGAAAAGCTAAAACTAATAAGAGAATCAGAAAGATTAAAACTAAAGGAAATGTCTGATTTAACAGGGATTAATTACCATACATATCATGGATATGAATCAGGGAAAATGAATATGTCTTTAGAAGCAGCAACAAAACTATTTTCAATTCCAAGATTTAGAAAATATATGACTTGGTTTATGTTTGATGAAATCAATCCTGATGCTGGGCAAATCGCACCGGCACTCGCACACAGTGGGCAAGACAACACGCAATCATCCCACTCAGACAAGAAAATTGGATAACAATACATCAAGCATTTTGTGAATTTATTGATTCACAAAGCCTTTCTACC