Homologs in group_1692

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10975 FBDBKF_10975 46.9 Morganella morganii S1 dinI DinI family protein
EHELCC_05250 EHELCC_05250 46.9 Morganella morganii S2 dinI DinI family protein
NLDBIP_05570 NLDBIP_05570 46.9 Morganella morganii S4 dinI DinI family protein
LHKJJB_02450 LHKJJB_02450 46.9 Morganella morganii S3 dinI DinI family protein
HKOGLL_15830 HKOGLL_15830 46.9 Morganella morganii S5 dinI DinI family protein
F4V73_RS08250 F4V73_RS08250 42.0 Morganella psychrotolerans - DinI-like family protein

Distribution of the homologs in the orthogroup group_1692

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1692

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P21320 2.67e-16 69 38 0 76 3 None DinI-like protein in retron Ec67 Escherichia coli
P0A1G2 1.53e-14 65 35 1 78 3 impC Protein ImpC Shigella flexneri
P0A1G1 1.53e-14 65 35 1 78 3 impC Protein ImpC Escherichia coli
P0A1G0 1.53e-14 65 35 1 78 3 impC Protein ImpC Salmonella typhimurium
P41063 2.01e-06 45 25 0 75 1 TUM SOS operon TUM protein Escherichia phage 186
Q9FA32 5.2e-05 40 26 1 76 3 impC Protein ImpC Salmonella typhimurium
P0ABR4 0.000138 39 29 3 79 3 dinI DNA damage-inducible protein I Shigella flexneri
P0ABR1 0.000138 39 29 3 79 1 dinI DNA damage-inducible protein I Escherichia coli (strain K12)
P0ABR2 0.000138 39 29 3 79 3 dinI DNA damage-inducible protein I Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ABR3 0.000138 39 29 3 79 3 dinI DNA damage-inducible protein I Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS09650
Feature type CDS
Gene -
Product DinI-like family protein
Location 2106395 - 2106640 (strand: -1)
Length 246 (nucleotides) / 81 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1692
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06183 DinI-like family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K12149 DNA-damage-inducible protein I - -

Protein Sequence

MRVEILFNKQSNVTDSLFPLLEHELRKKIIPIYPDMQFRIAFSSMNTIQVTGVKDEAKHEHIMELIQSVWEDDSWLQTNDD

Flanking regions ( +/- flanking 50bp)

TATAATACTGTATTTATATACAGTTTATTTGCCTTGGTATGGTGAAAATAATGCGTGTGGAAATTTTATTTAACAAACAATCTAATGTCACTGACTCACTATTTCCGCTGTTAGAACATGAACTAAGAAAAAAAATTATTCCTATTTATCCTGATATGCAGTTTCGTATCGCTTTTAGTAGCATGAATACGATCCAAGTCACGGGCGTAAAAGATGAAGCTAAGCATGAGCATATTATGGAGTTAATTCAAAGTGTTTGGGAAGATGATAGTTGGCTCCAAACGAATGATGATTAACGACCAATTAAGTTAAACAGAGATTGCCAGAGCATCTTACTTTTATTGAT