Homologs in group_2327

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18105 FBDBKF_18105 34.8 Morganella morganii S1 sgaB Phosphotransferase system, galactitol-specific IIB component
EHELCC_16805 EHELCC_16805 34.8 Morganella morganii S2 sgaB Phosphotransferase system, galactitol-specific IIB component
NLDBIP_17645 NLDBIP_17645 34.8 Morganella morganii S4 sgaB Phosphotransferase system, galactitol-specific IIB component
LHKJJB_17565 LHKJJB_17565 34.8 Morganella morganii S3 sgaB Phosphotransferase system, galactitol-specific IIB component
HKOGLL_17380 HKOGLL_17380 34.8 Morganella morganii S5 sgaB Phosphotransferase system, galactitol-specific IIB component
F4V73_RS10310 F4V73_RS10310 34.8 Morganella psychrotolerans - PTS sugar transporter subunit IIB

Distribution of the homologs in the orthogroup group_2327

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2327

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9EXD8 1.33e-09 53 30 2 91 1 ulaB Ascorbate-specific PTS system EIIB component Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q8ZK89 3.82e-05 42 27 2 93 3 ulaB Ascorbate-specific PTS system EIIB component Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57GJ8 3.82e-05 42 27 2 93 3 ulaB Ascorbate-specific PTS system EIIB component Salmonella choleraesuis (strain SC-B67)
P69822 4.25e-05 42 27 2 93 1 ulaB Ascorbate-specific PTS system EIIB component Escherichia coli (strain K12)
P69823 4.25e-05 42 27 2 93 3 ulaB Ascorbate-specific PTS system EIIB component Escherichia coli O157:H7
Q328K3 0.000159 40 26 2 93 3 ulaB Ascorbate-specific PTS system EIIB component Shigella dysenteriae serotype 1 (strain Sd197)
Q3YUF4 0.000246 40 28 2 87 3 ulaB Ascorbate-specific PTS system EIIB component Shigella sonnei (strain Ss046)
Q83P29 0.000246 40 28 2 87 3 ulaB Ascorbate-specific PTS system EIIB component Shigella flexneri
Q31TC5 0.000246 40 28 2 87 3 ulaB Ascorbate-specific PTS system EIIB component Shigella boydii serotype 4 (strain Sb227)
Q8Z171 0.000246 40 28 2 87 3 ulaB Ascorbate-specific PTS system EIIB component Salmonella typhi
Q5PJ47 0.000246 40 28 2 87 3 ulaB Ascorbate-specific PTS system EIIB component Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8FAJ1 0.000246 40 28 2 87 3 ulaB Ascorbate-specific PTS system EIIB component Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS08710
Feature type CDS
Gene -
Product PTS sugar transporter subunit IIB
Location 1907755 - 1908042 (strand: -1)
Length 288 (nucleotides) / 95 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2327
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02302 PTS system, Lactose/Cellobiose specific IIB subunit

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3414 Carbohydrate transport and metabolism (G) G Phosphotransferase system, galactitol-specific IIB component

Kegg Ortholog Annotation(s)

Protein Sequence

MKITVVCGNGLGSSLMMEMSIKSILKDLAVNADVDHVDLGSAKGTPSDIYVGTRDIAEQLNAQAVNGKIVSLDNMIDKVAMKEKLSTALRELGAL

Flanking regions ( +/- flanking 50bp)

GCTGTTATTAATCACTATTAATTCAATTTTAAATAACCAAGGGGAATATGATGAAAATTACCGTTGTATGTGGAAATGGTTTAGGAAGTAGCTTAATGATGGAAATGAGCATCAAAAGTATTTTAAAAGATCTGGCCGTCAATGCTGATGTTGATCATGTCGATTTAGGTTCGGCAAAAGGGACACCGAGTGATATTTATGTGGGAACTCGTGATATTGCGGAACAACTTAATGCTCAAGCGGTTAATGGCAAAATTGTTTCTTTAGATAATATGATTGATAAAGTTGCGATGAAAGAGAAACTTTCGACCGCATTACGTGAATTAGGCGCGCTATAAGGAGCCTAGTATGGACTTTTTCCGCTTTCTAATGAGCGATGTGCTTTCAG