Homologs in group_3932

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_3932

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3932

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A0Q7 1.27e-18 80 31 2 129 3 vdlD Protein VdlD Helicobacter pylori (strain ATCC 700392 / 26695)
P0A0Q8 1.27e-18 80 31 2 129 3 vdlD Protein VdlD Helicobacter pylori (strain J99 / ATCC 700824)
P49851 8.98e-17 75 36 0 105 3 ykhA Uncharacterized acyl-CoA thioester hydrolase YkhA Bacillus subtilis (strain 168)
Q9PJK7 1.44e-15 72 32 0 109 3 TC_0822 Uncharacterized acyl-CoA thioester hydrolase TC_0822 Chlamydia muridarum (strain MoPn / Nigg)
P44886 1.77e-15 71 33 1 107 1 HI_0827 Uncharacterized acyl-CoA thioester hydrolase HI_0827 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O66120 2.06e-14 68 30 0 107 3 ZMO0511 Uncharacterized acyl-CoA thioester hydrolase ZMO0511 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q9Z7Q0 2.11e-14 68 32 0 109 3 CPn_0654 Uncharacterized acyl-CoA thioester hydrolase CPn_0654/CP_0093/CPj0654/CpB0680 Chlamydia pneumoniae
O84540 2.77e-14 68 32 0 106 3 CT_535 Uncharacterized acyl-CoA thioester hydrolase CT_535 Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
P0A1A1 6.18e-14 67 30 1 111 3 yciA Acyl-CoA thioester hydrolase YciA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1A2 6.18e-14 67 30 1 111 3 yciA Acyl-CoA thioester hydrolase YciA Salmonella typhi
P0A8Z2 4.75e-13 64 29 1 111 3 yciA Acyl-CoA thioester hydrolase YciA Shigella flexneri
P0A8Z0 4.75e-13 64 29 1 111 3 yciA Acyl-CoA thioester hydrolase YciA Escherichia coli (strain K12)
P0A8Z1 4.75e-13 64 29 1 111 3 yciA Acyl-CoA thioester hydrolase YciA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P42398 9.93e-13 63 26 1 127 3 BUsg_263 Uncharacterized acyl-CoA thioester hydrolase BUsg_263 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q89AL4 3.14e-12 62 30 1 112 3 bbp_254 Uncharacterized acyl-CoA thioester hydrolase bbp_254 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P57362 1.24e-11 61 24 1 127 3 BU274 Uncharacterized acyl-CoA thioester hydrolase BU274 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q91V12 1.37e-10 60 26 1 122 1 Acot7 Cytosolic acyl coenzyme A thioester hydrolase Mus musculus
Q64559 2.08e-10 60 25 1 124 1 Acot7 Cytosolic acyl coenzyme A thioester hydrolase Rattus norvegicus
Q8VHQ9 3.99e-09 57 29 0 110 1 Acot11 Acyl-coenzyme A thioesterase 11 Mus musculus
Q8VHQ9 6.28e-09 56 28 2 132 1 Acot11 Acyl-coenzyme A thioesterase 11 Mus musculus
Q8WXI4 9.44e-09 55 31 2 118 1 ACOT11 Acyl-coenzyme A thioesterase 11 Homo sapiens
Q8WXI4 7.01e-08 53 28 0 107 1 ACOT11 Acyl-coenzyme A thioesterase 11 Homo sapiens
O00154 1.31e-08 55 24 1 122 1 ACOT7 Cytosolic acyl coenzyme A thioester hydrolase Homo sapiens
Q8WYK0 1.88e-07 52 30 1 99 1 ACOT12 Acetyl-coenzyme A thioesterase Homo sapiens
Q8WYK0 0.000265 43 25 2 104 1 ACOT12 Acetyl-coenzyme A thioesterase Homo sapiens
Q9DBK0 2.74e-07 51 30 2 110 1 Acot12 Acetyl-coenzyme A thioesterase Mus musculus
Q6ZUV0 9.35e-07 49 32 1 93 5 ACOT7L Putative cytosolic acyl coenzyme A thioester hydrolase-like Homo sapiens
Q99NB7 1.72e-06 49 29 2 108 1 Acot12 Acetyl-coenzyme A thioesterase Rattus norvegicus

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS08275
Feature type CDS
Gene -
Product acyl-CoA thioesterase
Location 1808776 - 1809198 (strand: 1)
Length 423 (nucleotides) / 140 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3932
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF03061 Thioesterase superfamily

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1607 Lipid transport and metabolism (I) I Acyl-CoA hydrolase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K10806 acyl-CoA thioesterase YciA [EC:3.1.2.-] Biosynthesis of unsaturated fatty acids -

Protein Sequence

MSTTDLSLELQDKIKHSITRVSKVIFPTTTNHHSTLFGGTALAWMDEVSFITATRFCRKRLVTVSTEKINFNHPIPSGTIIELVGEVIRVGRTSLTVNVSIFLEEMYAEGREEVIHGQFNFVAVDEHGKPTPLFDKPSLL

Flanking regions ( +/- flanking 50bp)

ATTTTATACTTTAGGATCATCCCTACTGTATAGAAAGATAAGGTTTTATTATGTCCACAACGGATTTATCTCTAGAGTTGCAAGATAAAATTAAACACTCAATCACCCGCGTCTCTAAAGTTATTTTTCCAACCACGACCAATCATCACTCCACACTCTTTGGCGGAACGGCATTAGCATGGATGGATGAAGTCTCTTTTATTACCGCTACGCGCTTTTGCCGTAAACGTTTAGTGACAGTTTCTACAGAGAAAATTAATTTTAATCACCCTATTCCCTCTGGCACTATTATTGAATTAGTTGGTGAGGTAATACGTGTCGGGCGTACCAGTCTAACGGTAAATGTTTCTATTTTTCTCGAAGAGATGTATGCCGAAGGGCGAGAAGAAGTGATCCATGGCCAATTTAATTTTGTTGCCGTTGATGAGCATGGTAAGCCAACCCCTTTATTCGATAAACCATCGCTTTTATAACCGCTAATCTGTCGTTTTATTCTTCAAATTAAAAACGACAGATTTTATTA