Homologs in group_494

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00895 FBDBKF_00895 82.0 Morganella morganii S1 ttrB tetrathionate reductase subunit TtrB
EHELCC_00650 EHELCC_00650 82.0 Morganella morganii S2 ttrB tetrathionate reductase subunit TtrB
NLDBIP_02810 NLDBIP_02810 82.0 Morganella morganii S4 ttrB tetrathionate reductase subunit TtrB
LHKJJB_04325 LHKJJB_04325 82.0 Morganella morganii S3 ttrB tetrathionate reductase subunit TtrB
HKOGLL_02720 HKOGLL_02720 82.0 Morganella morganii S5 ttrB tetrathionate reductase subunit TtrB
F4V73_RS06890 F4V73_RS06890 83.3 Morganella psychrotolerans ttrB tetrathionate reductase subunit TtrB

Distribution of the homologs in the orthogroup group_494

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_494

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7CQM9 4.97e-149 418 80 0 244 1 ttrB Tetrathionate reductase subunit B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O30080 5.77e-50 165 44 7 204 3 ttrB Tetrathionate reductase subunit B Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q9HR73 2.52e-47 160 42 5 208 2 dmsB Putative dimethyl sulfoxide reductase iron-sulfur subunit B Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q7WTT9 3.27e-42 146 35 4 232 1 arrB Arsenate respiratory reductase iron-sulfur subunit ArrB Shewanella sp. (strain ANA-3)
O29751 3.32e-39 139 35 6 267 1 hmeA Hdr-like menaquinol oxidoreductase iron-sulfur subunit 1 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P31076 1.73e-38 135 38 5 189 4 psrB Polysulfide reductase chain B Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
P0AAK9 2.73e-38 136 36 7 225 3 nrfC Protein NrfC Shigella flexneri
P0AAK7 2.73e-38 136 36 7 225 3 nrfC Protein NrfC Escherichia coli (strain K12)
P0AAK8 2.73e-38 136 36 7 225 3 nrfC Protein NrfC Escherichia coli O157:H7
D3RNN7 3.95e-37 133 37 5 200 1 soeB Sulfite dehydrogenase subunit B Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
P0A1I1 2.37e-36 130 41 4 164 1 phsB Thiosulfate reductase electron transfer subunit PhsB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1I2 2.37e-36 130 41 4 164 3 phsB Thiosulfate reductase electron transfer subunit PhsB Salmonella typhi
P45015 3.79e-36 130 36 7 225 3 nrfC Protein NrfC homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P77375 1.14e-32 121 35 4 192 2 ydhX Uncharacterized ferredoxin-like protein YdhX Escherichia coli (strain K12)
Q8X616 1.15e-32 121 35 4 192 3 ydhX Uncharacterized ferredoxin-like protein YdhX Escherichia coli O157:H7
Q47CW7 3.6e-30 117 45 2 128 1 pcrB Perchlorate reductase subunit beta Dechloromonas aromatica (strain RCB)
Q8GPG3 3.36e-29 115 42 2 130 1 ddhB Dimethylsulfide dehydrogenase subunit beta Rhodovulum sulfidophilum
I3R9M8 5.07e-29 115 42 3 136 1 narH Respiratory nitrate reductase subunit beta Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)
Q9S1G9 7.77e-29 114 43 2 130 1 serB Selenate reductase subunit beta Thauera selenatis
P60069 9.34e-29 114 42 2 131 1 clrB Chlorate reductase subunit beta Ideonella dechloratans
Q83RZ7 7.78e-27 105 34 6 188 3 dmsB Anaerobic dimethyl sulfoxide reductase chain B Shigella flexneri
P18776 7.86e-27 105 34 6 188 1 dmsB Anaerobic dimethyl sulfoxide reductase chain B Escherichia coli (strain K12)
P0AAJ1 8.11e-27 105 35 6 188 3 ynfG Probable anaerobic dimethyl sulfoxide reductase chain YnfG Escherichia coli (strain K12)
P0AAJ2 8.11e-27 105 35 6 188 3 ynfG Probable anaerobic dimethyl sulfoxide reductase chain YnfG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q72E85 2.43e-26 105 30 7 227 1 qrcC Menaquinone reductase, iron-sulfur cluster-binding subunit Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P27273 9.83e-24 97 34 5 195 1 fdhB1 Formate dehydrogenase iron-sulfur subunit Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
P42176 2.04e-22 98 42 2 114 3 narH Nitrate reductase beta chain Bacillus subtilis (strain 168)
P45003 1.59e-21 92 34 3 144 3 dmsB Anaerobic dimethyl sulfoxide reductase chain B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P33389 2.19e-21 94 34 5 181 4 DVU_0535 Protein DVU_0535 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P0AAJ7 4.45e-21 92 28 4 190 3 fdoH Formate dehydrogenase-O iron-sulfur subunit Shigella flexneri
P0AAJ5 4.45e-21 92 28 4 190 1 fdoH Formate dehydrogenase-O iron-sulfur subunit Escherichia coli (strain K12)
P0AAJ6 4.45e-21 92 28 4 190 3 fdoH Formate dehydrogenase-O iron-sulfur subunit Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAJ4 1.06e-20 91 30 6 196 3 fdnH Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit Shigella flexneri
P0AAJ3 1.06e-20 91 30 6 196 1 fdnH Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit Escherichia coli (strain K12)
P80564 1.36e-20 90 30 7 197 1 bthL Pyrogallol hydroxytransferase small subunit Pelobacter acidigallici
Q83RN5 1.71e-20 93 40 2 112 3 narH Respiratory nitrate reductase 1 beta chain Shigella flexneri
P11349 1.71e-20 93 40 2 112 1 narH Respiratory nitrate reductase 1 beta chain Escherichia coli (strain K12)
P19318 2.25e-20 92 42 2 107 1 narY Respiratory nitrate reductase 2 beta chain Escherichia coli (strain K12)
P0AAK0 1.21e-19 89 34 12 238 3 hybA Hydrogenase-2 operon protein HybA Shigella flexneri
P0AAJ8 1.21e-19 89 34 12 238 3 hybA Hydrogenase-2 operon protein HybA Escherichia coli (strain K12)
P0AAJ9 1.21e-19 89 34 12 238 3 hybA Hydrogenase-2 operon protein HybA Escherichia coli O157:H7
P44450 2.73e-19 88 30 5 182 3 fdxH Formate dehydrogenase iron-sulfur subunit Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AAL8 2.48e-17 80 31 8 206 4 ydhY Uncharacterized ferredoxin-like protein YdhY Shigella flexneri
P0AAL6 2.48e-17 80 31 8 206 2 ydhY Uncharacterized ferredoxin-like protein YdhY Escherichia coli (strain K12)
P0AAL7 2.48e-17 80 31 8 206 4 ydhY Uncharacterized ferredoxin-like protein YdhY Escherichia coli O157:H7
P56256 4.86e-15 73 32 6 143 4 ysaA Putative electron transport protein YsaA Escherichia coli (strain K12)
P0AAK4 6.19e-15 73 31 5 157 3 hydN Electron transport protein HydN Escherichia coli (strain K12)
P0AAK5 6.19e-15 73 31 5 157 3 hydN Electron transport protein HydN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAK6 6.19e-15 73 31 5 157 3 hydN Electron transport protein HydN Escherichia coli O157:H7
Q57619 1.42e-14 72 38 6 120 3 MJ0155 Uncharacterized ferredoxin MJ0155 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P85098 2.02e-14 73 29 8 195 1 narH Respiratory nitrate reductase beta chain (Fragments) Bradyrhizobium sp.
Q8GC87 1.13e-12 68 29 8 187 1 fdhB Formate dehydrogenase subunit beta Megalodesulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759)
Q46819 2.04e-12 66 31 5 137 4 ygfS Putative electron transport protein YgfS Escherichia coli (strain K12)
Q46820 1.35e-11 67 30 5 127 2 uacF Putative oxidoreductase UacF Escherichia coli (strain K12)
P37127 7.95e-11 65 29 7 169 2 aegA Putative oxidoreductase AegA Escherichia coli (strain K12)
Q57713 4.02e-10 60 32 5 127 3 MJ0265 Uncharacterized ferredoxin MJ0265 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P0AAK3 1.49e-09 59 32 3 101 3 hycB Formate hydrogenlyase subunit 2 Shigella flexneri
P0AAK1 1.49e-09 59 32 3 101 1 hycB Formate hydrogenlyase subunit 2 Escherichia coli (strain K12)
P0AAK2 1.49e-09 59 32 3 101 3 hycB Formate hydrogenlyase subunit 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P23481 4e-09 58 36 5 95 2 hyfA Hydrogenase-4 component A Escherichia coli (strain K12)
P20925 8.07e-09 56 32 4 118 4 None Frd operon probable iron-sulfur subunit A (Fragment) Proteus vulgaris
Q8L3A9 1.32e-08 58 29 5 139 1 padI NADH-dependent phenylglyoxylate dehydrogenase subunit beta Aromatoleum evansii
P31894 1.35e-08 56 28 5 139 1 cooF Iron-sulfur protein Rhodospirillum rubrum
Q57712 3.38e-08 54 31 5 143 3 MJ0264 Uncharacterized protein MJ0264 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q727P4 1.54e-07 53 24 4 173 1 DVU_2811 Formate dehydrogenase 2 subunit beta (cytochrome c-553) Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q00388 9.9e-06 49 34 4 97 4 vhuB Polyferredoxin protein VhuB Methanococcus voltae
Q58567 0.00014 42 31 2 83 4 fwdG Polyferredoxin protein FwdG Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P60232 0.000375 44 43 1 44 1 mvhB Polyferredoxin protein MvhB Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q57563 0.000631 42 38 2 60 3 MJ0099 L-aspartate semialdehyde sulfurtransferase iron-sulfur subunit Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q50784 0.000696 43 43 1 44 4 mvhB Polyferredoxin protein MvhB Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q49180 0.001 43 35 3 80 4 mvhB Polyferredoxin protein MvhB Methanothermus fervidus

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS08235
Feature type CDS
Gene ttrB
Product tetrathionate reductase subunit TtrB
Location 1799361 - 1800101 (strand: -1)
Length 741 (nucleotides) / 246 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_494
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13247 4Fe-4S dicluster domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0437 Energy production and conversion (C) C Fe-S-cluster-containing dehydrogenase component (DMSO reductase)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08358 tetrathionate reductase subunit B Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system		 -

Protein Sequence

MDLGKRKFLQQLGVLTAGASLVPLSQAGIKLSPERREGSEDKRYGMLIDLRRCVGCQSCTVSCTIENQTPQGQFRTTVNQYQVAIKGQEGITNVLLPRLCNHCDEPPCVPVCPVQATFQRKDGIVVIDNERCVGCAYCVQACPYDARFINHSTQTADKCTFCAHRLEVGLLPACVESCVGGARIIGDMKDPHSTISKMIREHEHELKVLKPESGTLPQVFYLGLDDAFVQPLVGQGQPALWQEVHS

Flanking regions ( +/- flanking 50bp)

TCCCTTCGCTCAATGTGGCAGGTATTTACTGAGTGATACTGGAGACAAATATGGATCTTGGTAAACGAAAATTCTTACAACAATTAGGGGTCCTTACCGCAGGTGCTTCACTGGTTCCTCTCTCTCAAGCAGGCATTAAACTATCCCCAGAGCGCCGTGAAGGCTCAGAGGATAAACGTTATGGCATGCTGATCGATCTGCGTCGTTGTGTTGGGTGTCAATCTTGTACAGTGAGCTGTACGATTGAAAACCAAACGCCACAAGGACAATTTAGGACGACAGTAAACCAATATCAAGTTGCTATCAAGGGGCAAGAGGGAATAACGAACGTCTTACTCCCTAGATTATGTAACCATTGTGACGAGCCTCCGTGTGTACCTGTTTGTCCTGTTCAAGCAACATTTCAACGCAAAGACGGGATCGTCGTGATTGATAATGAACGTTGTGTAGGCTGTGCTTATTGTGTGCAAGCATGTCCTTATGATGCCCGTTTTATCAACCATTCCACTCAGACAGCCGATAAATGTACTTTTTGTGCTCATCGCCTAGAAGTTGGGTTATTACCTGCCTGTGTTGAATCTTGTGTGGGGGGCGCTCGTATTATCGGTGATATGAAAGATCCACACAGCACAATAAGTAAAATGATCCGCGAGCATGAACATGAATTAAAAGTACTTAAACCAGAAAGTGGCACCTTGCCACAAGTTTTTTATCTTGGTTTAGATGATGCATTTGTGCAGCCATTAGTTGGACAAGGGCAACCCGCATTATGGCAGGAGGTTCACTCATGATTTCATCCGTTTCGCAAATTCAAGAAGTGATAGCGATCCCCCAAGAATAC