Homologs in group_580

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01660 FBDBKF_01660 63.5 Morganella morganii S1 - DNA polymerase III subunit theta
EHELCC_02130 EHELCC_02130 63.5 Morganella morganii S2 - DNA polymerase III subunit theta
NLDBIP_01330 NLDBIP_01330 63.5 Morganella morganii S4 - DNA polymerase III subunit theta
LHKJJB_00705 LHKJJB_00705 63.5 Morganella morganii S3 - DNA polymerase III subunit theta
HKOGLL_00745 HKOGLL_00745 63.5 Morganella morganii S5 - DNA polymerase III subunit theta
F4V73_RS04000 F4V73_RS04000 67.6 Morganella psychrotolerans - DNA polymerase III subunit theta

Distribution of the homologs in the orthogroup group_580

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_580

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ABT1 2e-27 97 60 0 74 3 holE DNA polymerase III subunit theta Shigella flexneri
P0ABS8 2e-27 97 60 0 74 1 holE DNA polymerase III subunit theta Escherichia coli (strain K12)
P0ABS9 2e-27 97 60 0 74 3 holE DNA polymerase III subunit theta Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ABT0 2e-27 97 60 0 74 3 holE DNA polymerase III subunit theta Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS07820
Feature type CDS
Gene -
Product DNA polymerase III subunit theta
Location 1713879 - 1714103 (strand: 1)
Length 225 (nucleotides) / 74 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_580
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06440 DNA polymerase III, theta subunit

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02345 DNA polymerase III subunit theta [EC:2.7.7.7] DNA replication
Mismatch repair
Homologous recombination		 -

Protein Sequence

MGYNLAELTQEEKDKINVNLAASGVAFKERYNMPVVADAIAREQPQALQSYFQERVTFYRARSQHYSRLPFESK

Flanking regions ( +/- flanking 50bp)

ACTCATCGCTCTCTTTTACTTTACTCTCATATAACAAGGGAGAAAGTACGATGGGTTATAACCTTGCTGAACTTACACAAGAAGAAAAAGATAAAATTAATGTCAACCTAGCCGCTTCAGGGGTTGCCTTTAAAGAGCGTTATAATATGCCAGTAGTAGCTGATGCGATAGCAAGAGAGCAACCTCAAGCTTTACAAAGCTATTTTCAAGAAAGAGTGACCTTTTATCGAGCACGAAGCCAACACTATTCTCGCTTACCTTTTGAGTCGAAATAAATACCGTGCTCAATATTAAAAAAAGAGATAAACATTTACGTTTATCTCTT