Homologs in group_1831

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13560 FBDBKF_13560 79.3 Morganella morganii S1 yeaL DUF441 domain-containing protein
EHELCC_08535 EHELCC_08535 79.3 Morganella morganii S2 yeaL DUF441 domain-containing protein
NLDBIP_08860 NLDBIP_08860 79.3 Morganella morganii S4 yeaL DUF441 domain-containing protein
LHKJJB_05405 LHKJJB_05405 79.3 Morganella morganii S3 yeaL DUF441 domain-containing protein
HKOGLL_05510 HKOGLL_05510 79.3 Morganella morganii S5 yeaL DUF441 domain-containing protein
F4V73_RS03205 F4V73_RS03205 79.3 Morganella psychrotolerans - DUF441 domain-containing protein

Distribution of the homologs in the orthogroup group_1831

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1831

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EY74 2.37e-99 285 100 0 150 3 PMI1560 UPF0756 membrane protein PMI1560 Proteus mirabilis (strain HI4320)
Q7N3J0 2.16e-76 226 80 0 150 3 plu2726 UPF0756 membrane protein plu2726 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6D7R0 7.43e-72 215 78 0 150 3 ECA1265 UPF0756 membrane protein ECA1265 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DBS3 9.15e-72 215 79 0 150 3 PC1_1142 UPF0756 membrane protein PC1_1142 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A1JL11 1.57e-71 214 77 0 150 3 YE1142 UPF0756 membrane protein YE1142 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C6CC69 1.78e-68 206 75 0 149 3 Dd703_1075 UPF0756 membrane protein Dd703_1075 Musicola paradisiaca (strain Ech703)
C6CQK7 4.35e-66 200 74 0 149 3 Dd1591_2981 UPF0756 membrane protein Dd1591_2981 Dickeya chrysanthemi (strain Ech1591)
A9R2H3 2.25e-62 191 74 0 150 3 YpAngola_A3137 UPF0756 membrane protein YpAngola_A3137 Yersinia pestis bv. Antiqua (strain Angola)
Q74SD5 2.25e-62 191 74 0 150 3 YPO3057 UPF0756 membrane protein YPO3057/y1423/YP_2679 Yersinia pestis
B2K990 2.25e-62 191 74 0 150 3 YPTS_2884 UPF0756 membrane protein YPTS_2884 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q668G1 2.25e-62 191 74 0 150 3 YPTB2779 UPF0756 membrane protein YPTB2779 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1C5Q9 2.25e-62 191 74 0 150 3 YPA_2248 UPF0756 membrane protein YPA_2248 Yersinia pestis bv. Antiqua (strain Antiqua)
A4TMM7 2.25e-62 191 74 0 150 3 YPDSF_2162 UPF0756 membrane protein YPDSF_2162 Yersinia pestis (strain Pestoides F)
B1JSH0 2.25e-62 191 74 0 150 3 YPK_1367 UPF0756 membrane protein YPK_1367 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q1CK22 2.25e-62 191 74 0 150 3 YPN_1328 UPF0756 membrane protein YPN_1328 Yersinia pestis bv. Antiqua (strain Nepal516)
A7FG53 2.25e-62 191 74 0 150 3 YpsIP31758_1251 UPF0756 membrane protein YpsIP31758_1251 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2VET5 5.02e-62 190 65 0 145 3 ETA_17460 UPF0756 membrane protein ETA_17460 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A6T7P0 5.48e-59 182 67 0 131 3 KPN78578_11500 UPF0756 membrane protein KPN78578_11500 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XSD1 1.57e-58 181 67 0 131 3 KPK_3307 UPF0756 membrane protein KPK_3307 Klebsiella pneumoniae (strain 342)
A7MN87 1.7e-57 179 65 0 131 3 ESA_02180 UPF0756 membrane protein ESA_02180 Cronobacter sakazakii (strain ATCC BAA-894)
Q8Z6E5 5.74e-57 177 63 0 131 3 yeaL UPF0756 membrane protein YeaL Salmonella typhi
B4TU95 5.74e-57 177 63 0 131 3 yeaL UPF0756 membrane protein YeaL Salmonella schwarzengrund (strain CVM19633)
B5BA93 5.74e-57 177 63 0 131 3 yeaL UPF0756 membrane protein YeaL Salmonella paratyphi A (strain AKU_12601)
C0Q711 5.74e-57 177 63 0 131 3 yeaL UPF0756 membrane protein YeaL Salmonella paratyphi C (strain RKS4594)
A9N2A7 5.74e-57 177 63 0 131 3 yeaL UPF0756 membrane protein YeaL Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PHE0 5.74e-57 177 63 0 131 3 yeaL UPF0756 membrane protein YeaL Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T3W8 5.74e-57 177 63 0 131 3 yeaL UPF0756 membrane protein YeaL Salmonella newport (strain SL254)
B4TFR0 5.74e-57 177 63 0 131 3 yeaL UPF0756 membrane protein YeaL Salmonella heidelberg (strain SL476)
B5RB26 5.74e-57 177 63 0 131 3 yeaL UPF0756 membrane protein YeaL Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QWM0 5.74e-57 177 63 0 131 3 yeaL UPF0756 membrane protein YeaL Salmonella enteritidis PT4 (strain P125109)
B5FJH1 5.74e-57 177 63 0 131 3 yeaL UPF0756 membrane protein YeaL Salmonella dublin (strain CT_02021853)
Q57Q14 5.74e-57 177 63 0 131 3 yeaL UPF0756 membrane protein YeaL Salmonella choleraesuis (strain SC-B67)
B5F873 5.74e-57 177 63 0 131 3 yeaL UPF0756 membrane protein YeaL Salmonella agona (strain SL483)
A8AHH7 6e-57 177 64 0 131 3 CKO_01811 UPF0756 membrane protein CKO_01811 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A9MFI4 7.71e-57 177 63 0 131 3 yeaL UPF0756 membrane protein YeaL Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q3Z2C9 1.7e-56 176 64 0 131 3 yeaL UPF0756 membrane protein YeaL Shigella sonnei (strain Ss046)
P0ACY8 1.7e-56 176 64 0 131 3 yeaL UPF0756 membrane protein YeaL Shigella flexneri
Q321S6 1.7e-56 176 64 0 131 3 yeaL UPF0756 membrane protein YeaL Shigella boydii serotype 4 (strain Sb227)
Q1RB03 1.7e-56 176 64 0 131 3 yeaL UPF0756 membrane protein YeaL Escherichia coli (strain UTI89 / UPEC)
B1LD87 1.7e-56 176 64 0 131 3 yeaL UPF0756 membrane protein YeaL Escherichia coli (strain SMS-3-5 / SECEC)
B6IBL2 1.7e-56 176 64 0 131 3 yeaL UPF0756 membrane protein YeaL Escherichia coli (strain SE11)
B7NBD4 1.7e-56 176 64 0 131 3 yeaL UPF0756 membrane protein YeaL Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0ACY6 1.7e-56 176 64 0 131 3 yeaL UPF0756 membrane protein YeaL Escherichia coli (strain K12)
B1IPE3 1.7e-56 176 64 0 131 3 yeaL UPF0756 membrane protein YeaL Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0ACY7 1.7e-56 176 64 0 131 3 yeaL UPF0756 membrane protein YeaL Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TH40 1.7e-56 176 64 0 131 3 yeaL UPF0756 membrane protein YeaL Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A0Y2 1.7e-56 176 64 0 131 3 yeaL UPF0756 membrane protein YeaL Escherichia coli O9:H4 (strain HS)
B1XGP9 1.7e-56 176 64 0 131 3 yeaL UPF0756 membrane protein YeaL Escherichia coli (strain K12 / DH10B)
C4ZZE5 1.7e-56 176 64 0 131 3 yeaL UPF0756 membrane protein YeaL Escherichia coli (strain K12 / MC4100 / BW2952)
C5W4W1 1.7e-56 176 64 0 131 3 yeaL UPF0756 membrane protein YeaL Escherichia coli (strain B / BL21-DE3)
B7M1K3 1.7e-56 176 64 0 131 3 yeaL UPF0756 membrane protein YeaL Escherichia coli O8 (strain IAI1)
B7MVS1 1.7e-56 176 64 0 131 3 yeaL UPF0756 membrane protein YeaL Escherichia coli O81 (strain ED1a)
B7NSY7 1.7e-56 176 64 0 131 3 yeaL UPF0756 membrane protein YeaL Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MBJ8 1.7e-56 176 64 0 131 3 yeaL UPF0756 membrane protein YeaL Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZMQ9 1.7e-56 176 64 0 131 3 yeaL UPF0756 membrane protein YeaL Escherichia coli O139:H28 (strain E24377A / ETEC)
B7L6R4 3.24e-56 175 64 0 131 3 yeaL UPF0756 membrane protein YeaL Escherichia coli (strain 55989 / EAEC)
B2U422 5.65e-56 175 63 0 131 3 yeaL UPF0756 membrane protein YeaL Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
C6UX49 8.38e-56 174 63 0 131 3 yeaL UPF0756 membrane protein YeaL Escherichia coli O157:H7 (strain TW14359 / EHEC)
B5YQS6 8.38e-56 174 63 0 131 3 yeaL UPF0756 membrane protein YeaL Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XDT4 8.38e-56 174 63 0 131 3 yeaL UPF0756 membrane protein YeaL Escherichia coli O157:H7
B0V7A3 2.01e-55 173 65 0 129 3 ABAYE1440 UPF0756 membrane protein ABAYE1440 Acinetobacter baumannii (strain AYE)
C6UJA3 3.18e-55 173 63 0 131 3 yeaL UPF0756 membrane protein YeaL Escherichia coli (strain B / REL606)
A3M6K4 3.7e-55 173 65 0 129 3 A1S_2121 UPF0756 membrane protein A1S_2121 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VM56 4.32e-55 172 65 0 129 3 ABSDF1616 UPF0756 membrane protein ABSDF1616 Acinetobacter baumannii (strain SDF)
B7H133 4.32e-55 172 65 0 129 3 ABBFA_001344 UPF0756 membrane protein ABBFA_001344 Acinetobacter baumannii (strain AB307-0294)
B2HTU4 5.74e-55 172 65 0 129 3 ACICU_02320 UPF0756 membrane protein ACICU_02320 Acinetobacter baumannii (strain ACICU)
Q32FU7 6.89e-54 169 62 0 131 3 yeaL UPF0756 membrane protein YeaL Shigella dysenteriae serotype 1 (strain Sd197)
C4K3H9 2.19e-53 168 56 0 149 3 HDEF_0364 UPF0756 membrane protein HDEF_0364 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B7IB69 8.41e-53 167 64 0 129 3 AB57_2455 UPF0756 membrane protein AB57_2455 Acinetobacter baumannii (strain AB0057)
Q2NS78 9.7e-53 167 72 0 150 3 SG1722 UPF0756 membrane protein SG1722 Sodalis glossinidius (strain morsitans)
A4W9G6 2.38e-52 166 67 0 146 3 Ent638_1667 UPF0756 membrane protein Ent638_1667 Enterobacter sp. (strain 638)
Q6F9V4 5.39e-52 165 57 0 147 3 ACIAD2383 UPF0756 membrane protein ACIAD2383 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B7USG9 3.86e-49 157 63 0 131 3 yeaL UPF0756 membrane protein YeaL Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B3H0M8 4.84e-49 157 59 1 145 3 APP7_0388 UPF0756 membrane protein APP7_0388 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0BTB8 4.84e-49 157 59 1 145 3 APJL_0384 UPF0756 membrane protein APJL_0384 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3MZ84 4.84e-49 157 59 1 145 3 APL_0366 UPF0756 membrane protein APL_0366 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B7LSP0 1.55e-47 153 63 0 131 3 yeaL UPF0756 membrane protein YeaL Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q8ZPW7 9.26e-47 151 61 0 113 3 yeaL UPF0756 membrane protein YeaL Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q0I372 1.11e-40 136 52 1 129 3 HS_0993 UPF0756 membrane protein HS_0993 Histophilus somni (strain 129Pt)
A9M2Z3 1.65e-40 135 50 1 147 3 NMCC_1816 UPF0756 membrane protein NMCC_1816 Neisseria meningitidis serogroup C (strain 053442)
P44110 2.57e-40 135 52 1 129 3 HI_1074 UPF0756 membrane protein HI_1074 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B0UUJ2 3.29e-40 135 51 1 129 3 HSM_1471 UPF0756 membrane protein HSM_1471 Histophilus somni (strain 2336)
C6AMB3 3.53e-40 135 51 1 129 3 NT05HA_0561 UPF0756 membrane protein NT05HA_0561 Aggregatibacter aphrophilus (strain NJ8700)
A1KVV6 4.04e-40 134 50 2 144 3 NMC1845 UPF0756 membrane protein NMC1845 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q4QLL5 4.06e-40 135 52 1 129 3 NTHI1233 UPF0756 membrane protein NTHI1233 Haemophilus influenzae (strain 86-028NP)
A1ITY7 4.56e-40 134 50 2 144 3 NMA2160 UPF0756 membrane protein NMA2160 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A5UIJ7 1.33e-39 133 51 1 129 3 CGSHiGG_08995 UPF0756 membrane protein CGSHiGG_08995 Haemophilus influenzae (strain PittGG)
A5UD33 8.15e-39 131 51 1 129 3 CGSHiEE_06715 UPF0756 membrane protein CGSHiEE_06715 Haemophilus influenzae (strain PittEE)
A6VNG9 2.4e-38 130 50 1 128 3 Asuc_1151 UPF0756 membrane protein Asuc_1151 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q65SL4 6.34e-38 129 48 1 129 3 MS1439 UPF0756 membrane protein MS1439 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B8F792 8.48e-38 129 57 1 133 3 HAPS_1649 UPF0756 membrane protein HAPS_1649 Glaesserella parasuis serovar 5 (strain SH0165)
B4RNN7 1.79e-37 128 50 2 144 3 NGK_2061 UPF0756 membrane protein NGK_2061 Neisseria gonorrhoeae (strain NCCP11945)
Q5F688 1.79e-37 128 50 2 144 3 NGO1674 UPF0756 membrane protein NGO1674 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q7VMB8 4.35e-37 127 53 1 145 3 HD_1071 UPF0756 membrane protein HD_1071 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9CMP4 4.44e-33 117 55 1 130 3 PM0771 UPF0756 membrane protein PM0771 Pasteurella multocida (strain Pm70)
C0ZEP4 1.1e-31 113 51 0 139 3 BBR47_32760 UPF0756 membrane protein BBR47_32760 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q67L13 1.79e-30 110 40 0 138 3 STH2648 UPF0756 membrane protein STH2648 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
C0ZBY5 1.82e-29 107 39 0 138 3 BBR47_23170 UPF0756 membrane protein BBR47_23170 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A5D176 2.43e-27 102 37 0 138 3 PTH_1817 UPF0756 membrane protein PTH_1817 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
B2A6J4 6.06e-27 101 36 0 141 3 Nther_1957 UPF0756 membrane protein Nther_1957 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
B1YKA9 2.11e-26 100 40 1 144 3 Exig_2210 UPF0756 membrane protein Exig_2210 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q2RM80 1.42e-24 95 36 0 111 3 Moth_0120 UPF0756 membrane protein Moth_0120 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
C4L477 2.96e-24 94 39 1 143 3 EAT1b_0668 UPF0756 membrane protein EAT1b_0668 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
B7GGT5 8.86e-23 90 39 2 136 3 Aflv_0503 UPF0756 membrane protein Aflv_0503 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
C6CU08 7.55e-22 88 35 0 138 3 Pjdr2_2290 UPF0756 membrane protein Pjdr2_2290 Paenibacillus sp. (strain JDR-2)
A7Z7K2 1.68e-21 87 38 1 125 3 RBAM_026200 UPF0756 membrane protein RBAM_026200 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q5KWB4 5.68e-21 86 38 1 122 3 GK2737 UPF0756 membrane protein GK2737 Geobacillus kaustophilus (strain HTA426)
B7HFA9 9.69e-21 85 39 1 123 3 BCB4264_A4705 UPF0756 membrane protein BCB4264_A4705 Bacillus cereus (strain B4264)
O34811 1.27e-20 85 39 1 125 3 ytwI UPF0756 membrane protein YtwI Bacillus subtilis (strain 168)
Q03F77 1.41e-20 85 36 1 127 3 PEPE_1090 UPF0756 membrane protein PEPE_1090 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q65G86 1.53e-20 85 36 1 127 3 BLi03063 UPF0756 membrane protein BLi03063/BL00400 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B7IJZ3 1.75e-20 85 38 1 123 3 BCG9842_B0533 UPF0756 membrane protein BCG9842_B0533 Bacillus cereus (strain G9842)
C3L8X4 1.75e-20 85 38 1 123 3 BAMEG_4871 UPF0756 membrane protein BAMEG_4871 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PAI4 1.75e-20 85 38 1 123 3 BAA_4851 UPF0756 membrane protein BAA_4851 Bacillus anthracis (strain A0248)
Q72ZE2 1.75e-20 85 38 1 123 3 BCE_4726 UPF0756 membrane protein BCE_4726 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7HRN5 1.75e-20 85 38 1 123 3 BCAH187_A4721 UPF0756 membrane protein BCAH187_A4721 Bacillus cereus (strain AH187)
B7JRW8 1.75e-20 85 38 1 123 3 BCAH820_4710 UPF0756 membrane protein BCAH820_4710 Bacillus cereus (strain AH820)
C1EUT9 1.75e-20 85 38 1 123 3 BCA_4705 UPF0756 membrane protein BCA_4705 Bacillus cereus (strain 03BB102)
Q812P5 1.75e-20 85 38 1 123 3 BC_4596 UPF0756 membrane protein BC_4596 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81KZ4 1.75e-20 85 38 1 123 3 BA_4840 UPF0756 membrane protein BA_4840/GBAA_4840/BAS4489 Bacillus anthracis
A9VJQ7 1.75e-20 85 38 1 123 3 BcerKBAB4_4425 UPF0756 membrane protein BcerKBAB4_4425 Bacillus mycoides (strain KBAB4)
Q633K2 1.75e-20 85 38 1 123 3 BCE33L4336 UPF0756 membrane protein BCE33L4336 Bacillus cereus (strain ZK / E33L)
Q6HCT7 1.75e-20 85 38 1 123 3 BT9727_4324 UPF0756 membrane protein BT9727_4324 Bacillus thuringiensis subsp. konkukian (strain 97-27)
A0RJJ3 1.75e-20 85 38 1 123 3 BALH_4179 UPF0756 membrane protein BALH_4179 Bacillus thuringiensis (strain Al Hakam)
B9J095 4.86e-20 84 37 1 123 3 BCQ_4399 UPF0756 membrane protein BCQ_4399 Bacillus cereus (strain Q1)
A4IRQ2 5.68e-20 83 37 1 132 3 GTNG_2661 UPF0756 membrane protein GTNG_2661 Geobacillus thermodenitrificans (strain NG80-2)
A7GTP0 9.99e-20 83 38 1 123 3 Bcer98_3279 UPF0756 membrane protein Bcer98_3279 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q5WEF9 1.06e-19 83 38 1 125 3 ABC2716 UPF0756 membrane protein ABC2716 Shouchella clausii (strain KSM-K16)
C5D657 1.56e-19 82 37 1 123 3 GWCH70_2680 UPF0756 membrane protein GWCH70_2680 Geobacillus sp. (strain WCH70)
Q9K846 3.94e-19 81 41 2 107 3 BH3161 UPF0756 membrane protein BH3161 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A4J550 8.98e-19 80 33 0 131 3 Dred_1676 UPF0756 membrane protein Dred_1676 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q38WU8 9.41e-19 80 30 1 127 3 LSA1031 UPF0756 membrane protein LSA1031 Latilactobacillus sakei subsp. sakei (strain 23K)
Q1WTL2 9.62e-19 80 32 2 140 3 LSL_0936 UPF0756 membrane protein LSL_0936 Ligilactobacillus salivarius (strain UCC118)
A8FG51 1.68e-18 79 36 1 125 3 BPUM_2558 UPF0756 membrane protein BPUM_2558 Bacillus pumilus (strain SAFR-032)
Q88VY3 1.91e-18 79 34 2 141 3 lp_1894 UPF0756 membrane protein lp_1894 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
C6VQL6 1.91e-18 79 34 2 141 3 JDM1_1594 UPF0756 membrane protein JDM1_1594 Lactiplantibacillus plantarum (strain JDM1)
A5D1P8 4.09e-18 79 32 2 144 3 PTH_1668 UPF0756 membrane protein PTH_1668 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
A5VK34 4.34e-18 78 30 1 137 3 Lreu_0946 UPF0756 membrane protein Lreu_0946 Limosilactobacillus reuteri (strain DSM 20016)
B2G7H6 4.34e-18 78 30 1 137 3 LAR_0892 UPF0756 membrane protein LAR_0892 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
B0TA81 1.18e-17 77 35 0 100 3 Helmi_09930 UPF0756 membrane protein Helmi_09930 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q039H8 1.58e-17 77 32 1 137 3 LSEI_1366 UPF0756 membrane protein LSEI_1366 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
A0AJ17 2.08e-17 77 33 1 124 3 lwe1581 UPF0756 membrane protein lwe1581 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A4J3H9 2.49e-17 76 30 0 139 3 Dred_1097 UPF0756 membrane protein Dred_1097 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
B3WE66 2.61e-17 76 32 1 137 3 LCABL_15860 UPF0756 membrane protein LCABL_15860 Lacticaseibacillus casei (strain BL23)
A0PY40 3.16e-17 76 34 1 136 3 NT01CX_1209 UPF0756 membrane protein NT01CX_1209 Clostridium novyi (strain NT)
A8YUY6 5.49e-17 75 31 1 127 3 lhv_0995 UPF0756 membrane protein lhv_0995 Lactobacillus helveticus (strain DPC 4571)
Q92BE7 9.81e-17 75 33 1 124 3 lin1603 UPF0756 membrane protein lin1603 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q71Z99 1.99e-16 74 32 1 124 3 LMOf2365_1590 UPF0756 membrane protein LMOf2365_1590 Listeria monocytogenes serotype 4b (strain F2365)
C1KVL5 1.99e-16 74 32 1 124 3 Lm4b_01579 UPF0756 membrane protein Lm4b_01579 Listeria monocytogenes serotype 4b (strain CLIP80459)
B8DHI0 1.99e-16 74 32 1 124 3 LMHCC_1001 UPF0756 membrane protein LMHCC_1001 Listeria monocytogenes serotype 4a (strain HCC23)
Q8Y6W3 2.62e-16 74 32 1 124 3 lmo1568 UPF0756 membrane protein lmo1568 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q835X3 4.01e-16 73 31 1 129 3 EF_1246 UPF0756 membrane protein EF_1246 Enterococcus faecalis (strain ATCC 700802 / V583)
B9E0Q4 8.67e-16 72 31 2 124 3 CKR_1028 UPF0756 membrane protein CKR_1028 Clostridium kluyveri (strain NBRC 12016)
Q5FKJ8 1.41e-15 72 31 1 127 3 LBA0919 UPF0756 membrane protein LBA0919 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
B8D0I7 5.18e-15 70 26 0 132 3 Hore_21770 UPF0756 membrane protein Hore_21770 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
B1I4G8 1.8e-14 69 34 0 122 3 Daud_1310 UPF0756 membrane protein Daud_1310 Desulforudis audaxviator (strain MP104C)
C0Z7G8 2.22e-14 68 30 0 138 3 BBR47_12340 UPF0756 membrane protein BBR47_12340 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q2RJR6 4.94e-14 68 33 2 109 3 Moth_1009 UPF0756 membrane protein Moth_1009 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q97MU9 3.23e-13 66 31 2 144 3 CA_C0092 UPF0756 membrane protein CA_C0092 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS07600
Feature type CDS
Gene -
Product DUF441 domain-containing protein
Location 1658481 - 1658933 (strand: -1)
Length 453 (nucleotides) / 150 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1831
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04284 Protein of unknown function (DUF441)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2707 Function unknown (S) S Uncharacterized membrane protein, DUF441 family

Protein Sequence

MSNVDPSLLILLVLAGLGIISHNMTVTLAMIFLLVIKITPLNQYFPLVEKYGMTIGILILTIGVMTPIATGRISAQEVFNSFLNWKSLLAIAIGIIVSWLGARGVSLMNNQPSTVAGLLVGTVIGVALFRGVPVGPLIAAGILSLLIGKS

Flanking regions ( +/- flanking 50bp)

CTTAAATGATATTAGAATGATTCAGAGAAAGAGAAGGATTATAAAAATAGATGAGTAATGTTGATCCCTCATTGCTAATTTTGCTGGTACTCGCAGGCCTGGGCATTATTAGTCATAATATGACTGTCACTTTAGCGATGATCTTTTTATTGGTTATTAAAATCACACCGTTAAACCAATATTTTCCATTAGTCGAAAAATACGGTATGACCATTGGGATCTTGATCCTCACCATAGGTGTTATGACACCGATTGCCACAGGCCGCATTTCCGCACAAGAAGTTTTCAATTCTTTTTTAAATTGGAAATCATTACTAGCGATTGCAATTGGTATCATCGTCTCTTGGTTAGGGGCACGGGGGGTGTCACTTATGAATAACCAACCGTCAACGGTAGCGGGTTTACTCGTAGGAACTGTTATTGGTGTCGCTCTATTTAGAGGGGTTCCAGTAGGTCCACTGATTGCTGCGGGGATCCTTTCGTTATTGATAGGTAAGTCATAGTAGTGCCATCTTTAGATTTATTGCGCTATCAACAAGCCTTCGCTCGACTA