Homologs in group_981

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05420 FBDBKF_05420 64.0 Morganella morganii S1 pncA bifunctional nicotinamidase/pyrazinamidase
EHELCC_12170 EHELCC_12170 64.0 Morganella morganii S2 pncA bifunctional nicotinamidase/pyrazinamidase
NLDBIP_12510 NLDBIP_12510 64.0 Morganella morganii S4 pncA bifunctional nicotinamidase/pyrazinamidase
LHKJJB_12370 LHKJJB_12370 64.0 Morganella morganii S3 pncA bifunctional nicotinamidase/pyrazinamidase
HKOGLL_10985 HKOGLL_10985 64.0 Morganella morganii S5 pncA bifunctional nicotinamidase/pyrazinamidase
F4V73_RS03875 F4V73_RS03875 62.6 Morganella psychrotolerans pncA bifunctional nicotinamidase/pyrazinamidase

Distribution of the homologs in the orthogroup group_981

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_981

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P21369 2.11e-83 249 59 0 202 1 pncA Nicotinamidase Escherichia coli (strain K12)
Q6F6U3 2.5e-41 142 39 3 209 1 pncA Nicotinamidase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P53184 5.82e-28 108 30 5 215 1 PNC1 Nicotinamidase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9USS0 6.83e-26 102 36 5 188 3 pnc1 Nicotinamidase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
I6XD65 3.85e-25 100 34 7 205 1 pncA Nicotinamidase/pyrazinamidase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q93Z51 1.69e-08 55 28 9 180 2 At3g16190 Probable inactive nicotinamidase At3g16190 Arabidopsis thaliana
P37532 1.85e-07 52 28 7 150 3 yaaI Uncharacterized isochorismatase family protein YaaI Bacillus subtilis (strain 168)
A0A2N6JFX7 1.61e-06 50 22 7 213 1 trtA Triuret hydrolase TrtA Herbaspirillum sp. (strain BH-1)
P94573 1.96e-05 47 23 5 192 3 ywoC Uncharacterized isochorismatase family protein YwoC Bacillus subtilis (strain 168)
P0ADI7 0.000285 43 24 7 186 1 yecD Isochorismatase family protein YecD Escherichia coli (strain K12)
P0ADI8 0.000285 43 24 7 186 3 yecD Uncharacterized isochorismatase family protein YecD Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS07275
Feature type CDS
Gene pncA
Product bifunctional nicotinamidase/pyrazinamidase
Location 1594029 - 1594670 (strand: 1)
Length 642 (nucleotides) / 213 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_981
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00857 Isochorismatase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1335 Coenzyme transport and metabolism (H)
General function prediction only (R)		 HR Nicotinamidase-related amidase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08281 nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-] Nicotinate and nicotinamide metabolism
Metabolic pathways
Biosynthesis of cofactors		 -

Protein Sequence

MKNSALLLVDLQNDFCTGGALAVKESDTVIDTANRLIDYFQRHQRPIIASKDWHPADHLSFAKNSGTVVGEIGQLNGRPQVWWPVHCVQNSHGADFHPLLTDDLISHIIYKGQNRLIDSYSAFFDNDHEYQTGLHTLLQSMQIEHLTILGIATDYCVKFTVLDALQLGYQVSVVMDGCRGVNIQPDDSQLAFNQMQQHGAVLVDSVTMLKSDK

Flanking regions ( +/- flanking 50bp)

GTGAAATGACATTAAACGATGACGACTAGGTCTAATCAAAGGTAACTCCTGTGAAAAATTCAGCGTTATTATTAGTTGATCTACAAAATGATTTCTGTACCGGTGGCGCATTGGCTGTTAAGGAAAGTGATACCGTCATAGATACGGCAAATCGACTTATTGATTATTTTCAACGCCATCAGCGTCCTATTATTGCGAGTAAAGATTGGCATCCCGCAGATCATCTCAGCTTTGCAAAAAATTCAGGTACTGTTGTTGGCGAAATTGGCCAATTAAATGGCCGCCCACAAGTTTGGTGGCCAGTGCATTGTGTACAAAATAGCCATGGCGCTGATTTTCATCCATTATTAACAGATGATTTAATTAGTCATATTATTTATAAAGGCCAAAATCGACTTATCGATAGTTATAGTGCTTTTTTTGATAATGACCATGAATATCAAACAGGATTGCATACTCTTTTACAAAGCATGCAGATCGAGCATCTCACCATTCTAGGGATAGCAACTGATTATTGCGTTAAATTTACCGTGTTAGATGCATTACAATTGGGTTATCAAGTATCAGTGGTTATGGATGGTTGTCGAGGTGTCAATATTCAACCAGATGATAGCCAACTCGCATTTAATCAAATGCAACAACATGGGGCAGTTTTAGTTGATTCAGTAACAATGCTTAAAAGTGACAAATAATATAAACAACATGATTAGCAATTATCATTCTCTACTTGTATGAATAGTAG