Homologs in group_3838

Help

1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
F4V73_RS03460 F4V73_RS03460 48.4 Morganella psychrotolerans - hemin uptake protein HemP

Distribution of the homologs in the orthogroup group_3838

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3838

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P31516 9.58e-12 57 50 0 53 4 hemP Hemin uptake protein HemP Yersinia enterocolitica
P0ACX9 1.32e-06 44 50 1 46 1 ydiE Uncharacterized protein YdiE Escherichia coli (strain K12)
P0ACY0 1.32e-06 44 50 1 46 4 ydiE Uncharacterized protein YdiE Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS06890
Feature type CDS
Gene -
Product hemin uptake protein HemP
Location 1507036 - 1507260 (strand: 1)
Length 225 (nucleotides) / 74 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3838
Orthogroup size 2
N. genomes 2

Actions

Genomic region

Domains

PF10636 Hemin uptake protein hemP

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4256 Coenzyme transport and metabolism (H) H Hemin uptake protein HemP

Protein Sequence

MIIIIITSISIAIEMNKNVHNLNDSSITRETSSPVIQSINSIELLGKSGVVYIQHNGELYQLRQTKTGKLILTK

Flanking regions ( +/- flanking 50bp)

TTAGACGTTTACGTTAAAAAAAGCTTGTCTAAAATATTCTGATAACGATAATGATTATCATAATCATAACCTCTATCAGTATTGCTATTGAAATGAATAAAAATGTTCATAATTTAAACGATTCATCGATAACACGTGAAACAAGCTCCCCAGTCATTCAATCTATAAATAGCATAGAATTACTGGGTAAATCGGGCGTGGTTTATATTCAACATAACGGAGAGTTGTATCAGTTACGCCAAACAAAAACAGGAAAACTTATCCTAACAAAATAATTATTTAATCCCTTTTCGCAAGCCACCTATTTTGCTAGGCAGCCAGCTAA