Homologs in group_941

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05120 FBDBKF_05120 73.2 Morganella morganii S1 - DUF2498 domain-containing protein
EHELCC_12470 EHELCC_12470 73.2 Morganella morganii S2 - DUF2498 domain-containing protein
NLDBIP_12810 NLDBIP_12810 73.2 Morganella morganii S4 - DUF2498 domain-containing protein
LHKJJB_12670 LHKJJB_12670 73.2 Morganella morganii S3 - DUF2498 domain-containing protein
HKOGLL_11285 HKOGLL_11285 73.2 Morganella morganii S5 - DUF2498 domain-containing protein
F4V73_RS05575 F4V73_RS05575 65.9 Morganella psychrotolerans - DUF2498 family protein

Distribution of the homologs in the orthogroup group_941

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_941

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AB64 3.26e-37 122 70 0 82 1 yciN Protein YciN Shigella flexneri
P0AB61 3.26e-37 122 70 0 82 1 yciN Protein YciN Escherichia coli (strain K12)
P0AB62 3.26e-37 122 70 0 82 4 yciN Protein YciN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AB63 3.26e-37 122 70 0 82 4 yciN Protein YciN Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS06440
Feature type CDS
Gene -
Product YciN family protein
Location 1414054 - 1414302 (strand: 1)
Length 249 (nucleotides) / 82 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_941
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF10692 Protein of unknown function (DUF2498)

Protein Sequence

MSTQTTPISAEMLLEKANKIIREHEDYLQGMYADSVEQKGNVLVFKGEFFLDEQGLPTAKSTAAFNMFKHLAHVLSEKYHLA

Flanking regions ( +/- flanking 50bp)

CCTGATAAAAAGCGAGGCGCAACAAATTATTTTTCTAAGGAGCATAAATGATGTCGACACAAACTACACCTATTTCCGCAGAGATGCTACTTGAAAAAGCGAATAAAATCATACGTGAACATGAAGACTATTTACAAGGTATGTACGCAGATTCTGTTGAACAAAAAGGCAATGTACTGGTATTTAAAGGCGAATTTTTTTTAGATGAGCAGGGTTTACCCACGGCTAAAAGTACCGCTGCATTCAATATGTTTAAACATTTAGCACATGTGTTATCTGAAAAATACCATCTAGCGTGATGATGTTTGCTGACTATTTTGGCACTTATTGCCAAGAAATCGGTTATTAA