Homologs in group_1800

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13365 FBDBKF_13365 77.8 Morganella morganii S1 arnD 4-deoxy-4-formamido-L-arabinose-phosphoundecapren ol deformylase
EHELCC_08730 EHELCC_08730 77.8 Morganella morganii S2 arnD 4-deoxy-4-formamido-L-arabinose-phosphoundecapren ol deformylase
NLDBIP_09055 NLDBIP_09055 77.8 Morganella morganii S4 arnD 4-deoxy-4-formamido-L-arabinose-phosphoundecapren ol deformylase
LHKJJB_05210 LHKJJB_05210 77.8 Morganella morganii S3 arnD 4-deoxy-4-formamido-L-arabinose-phosphoundecapren ol deformylase
HKOGLL_05705 HKOGLL_05705 77.8 Morganella morganii S5 arnD 4-deoxy-4-formamido-L-arabinose-phosphoundecapren ol deformylase
F4V73_RS03395 F4V73_RS03395 77.4 Morganella psychrotolerans arnD 4-deoxy-4-formamido-L-arabinose- phosphoundecaprenol deformylase

Distribution of the homologs in the orthogroup group_1800

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1800

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4ETL8 0.0 617 100 0 297 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Proteus mirabilis (strain HI4320)
Q7N3Q8 7.57e-180 500 77 0 296 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GDR8 5.73e-172 480 75 0 297 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Serratia proteamaculans (strain 568)
A1JPN1 7.47e-169 473 72 0 297 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JJ31 2.69e-165 464 70 0 297 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q7BF86 3e-165 463 70 0 297 2 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TIM5 3e-165 463 70 0 297 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Yersinia pestis (strain Pestoides F)
Q1CIH8 3e-165 463 70 0 297 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Yersinia pestis bv. Antiqua (strain Nepal516)
A9R092 3e-165 463 70 0 297 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Yersinia pestis bv. Antiqua (strain Angola)
Q7CIT9 3e-165 463 70 0 297 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Yersinia pestis
B2K5L2 3e-165 463 70 0 297 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C743 3e-165 463 70 0 297 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Yersinia pestis bv. Antiqua (strain Antiqua)
A7FHH5 3e-165 463 70 0 297 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q6D2F2 3.84e-147 417 66 0 296 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A4WAM2 1.95e-144 410 63 1 297 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Enterobacter sp. (strain 638)
B5XTL0 8.05e-139 396 63 1 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Klebsiella pneumoniae (strain 342)
B2VBI8 1.91e-138 395 61 1 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A6TF97 6.8e-138 394 62 1 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q2NRV8 1.13e-137 394 61 1 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Sodalis glossinidius (strain morsitans)
B7LM75 1.15e-137 394 61 1 297 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A0KGY5 1.9e-137 393 62 1 299 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q31YK1 1.02e-136 391 61 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Shigella boydii serotype 4 (strain Sb227)
B2TW39 1.02e-136 391 61 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q3YZV0 1.64e-136 390 61 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Shigella sonnei (strain Ss046)
Q0T2M7 1.64e-136 390 61 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Shigella flexneri serotype 5b (strain 8401)
P76472 1.64e-136 390 61 2 295 1 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Escherichia coli (strain K12)
B1IXT1 1.64e-136 390 61 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A2C3 1.64e-136 390 61 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Escherichia coli O9:H4 (strain HS)
B1X8W9 1.64e-136 390 61 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Escherichia coli (strain K12 / DH10B)
B5YXP9 2.63e-136 390 61 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XDZ2 2.63e-136 390 61 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Escherichia coli O157:H7
B6I7J9 2.72e-136 390 61 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Escherichia coli (strain SE11)
B7M5T8 2.72e-136 390 61 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Escherichia coli O8 (strain IAI1)
B7LAS1 2.72e-136 390 61 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Escherichia coli (strain 55989 / EAEC)
Q0TFI6 3.17e-136 390 61 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MXT7 3.17e-136 390 61 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Escherichia coli O81 (strain ED1a)
Q1R9F9 3.69e-136 390 61 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Escherichia coli (strain UTI89 / UPEC)
Q8FFM0 3.69e-136 390 61 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1ADA8 3.69e-136 390 61 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Escherichia coli O1:K1 / APEC
B7MG23 3.69e-136 390 61 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UFR8 3.69e-136 390 61 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZP74 6.74e-136 389 60 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Escherichia coli O139:H28 (strain E24377A / ETEC)
B7N5M1 1.04e-135 389 61 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A4SQX0 1.23e-135 388 62 2 299 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Aeromonas salmonicida (strain A449)
Q83KB7 1.34e-135 388 60 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Shigella flexneri
Q4ZSZ1 2.16e-135 387 60 1 293 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Pseudomonas syringae pv. syringae (strain B728a)
B1LLL0 1.22e-134 386 60 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Escherichia coli (strain SMS-3-5 / SECEC)
Q8Z539 1.48e-134 385 60 1 297 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Salmonella typhi
B5BCP5 1.48e-134 385 60 1 297 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Salmonella paratyphi A (strain AKU_12601)
Q5PNA7 1.48e-134 385 60 1 297 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
O52326 1.69e-134 385 60 1 295 1 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B7NNT5 1.9e-134 385 60 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q32DT2 1.94e-134 385 60 2 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Shigella dysenteriae serotype 1 (strain Sd197)
B4TPI3 2.02e-134 385 60 1 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Salmonella schwarzengrund (strain CVM19633)
Q57M55 2.54e-134 385 60 1 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Salmonella choleraesuis (strain SC-B67)
C0Q068 3.23e-134 385 60 1 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Salmonella paratyphi C (strain RKS4594)
A9N5B1 3.8e-134 385 60 1 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SYX2 9.75e-134 384 60 1 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Salmonella newport (strain SL254)
B5R273 1.05e-133 384 60 1 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Salmonella enteritidis PT4 (strain P125109)
B5FNU0 1.05e-133 384 60 1 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Salmonella dublin (strain CT_02021853)
Q4KC81 3.11e-133 382 60 1 292 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B5EZH9 3.25e-133 382 59 1 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Salmonella agona (strain SL483)
Q3KCC0 4.66e-133 382 60 1 292 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Pseudomonas fluorescens (strain Pf0-1)
B4TBG7 1.55e-132 380 59 1 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Salmonella heidelberg (strain SL476)
B5RCC5 1.57e-132 380 59 1 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q48HZ0 2.66e-129 372 59 1 293 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A6V1N9 7.53e-122 353 57 1 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Pseudomonas aeruginosa (strain PA7)
Q02R26 9.9e-122 353 57 1 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9HY62 1.75e-120 350 56 1 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7VBN1 1.75e-120 350 56 1 295 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Pseudomonas aeruginosa (strain LESB58)
A8FRR1 2.48e-102 304 52 5 296 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Shewanella sediminis (strain HAW-EB3)
Q8D340 6.45e-98 292 47 2 284 3 arnD Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD Wigglesworthia glossinidia brevipalpis

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS05085
Feature type CDS
Gene arnD
Product 4-deoxy-4-formamido-L-arabinose- phosphoundecaprenol deformylase
Location 1111761 - 1112654 (strand: 1)
Length 894 (nucleotides) / 297 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1800
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01522 Polysaccharide deacetylase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0726 Carbohydrate transport and metabolism (G)
Cell wall/membrane/envelope biogenesis (M)		 GM Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family

Kegg Ortholog Annotation(s)

Protein Sequence

MKKVGLRVDVDTYRGTKEGIPQLLDVFNKHNIQASFFFSVGPDNMGRHLWRLLKPKFLWKMLRSNAASLYGLDILLAGTAWPGKKIAKNLGYLMKQTQDAGHEVGLHSWDHQGWQAKVGRWSTEELMQQVRLGVEALEKALEKPVKCSAVAGWRADERVLMVKEAFQFDYNSDCRGTHPFRPVLENGSIGTVQIPVTLPTYDEVVGTKVKDEDFNQFIIDEIKKDQGIPVYTIHTEVEGMSKAAQFEQLLAMIANEGIEFCPLSHLLPQDIDMLPMGKVVRSDFPGREGWLGCQQEV

Flanking regions ( +/- flanking 50bp)

ACATTAGACTTCTTCTTACGTGGTGCAGTTGAAGAGTTAGGTAATAAGTAATGAAGAAAGTTGGCTTGAGAGTCGATGTGGATACTTATCGAGGTACAAAAGAAGGTATTCCACAATTGCTGGATGTCTTTAACAAGCATAACATTCAGGCCAGCTTTTTCTTCAGTGTCGGTCCAGATAATATGGGGCGCCATTTATGGCGCCTTTTAAAACCGAAATTTCTGTGGAAAATGCTAAGGTCGAATGCCGCTTCATTATATGGACTGGATATTCTATTAGCCGGTACGGCGTGGCCGGGTAAAAAAATTGCCAAAAATTTAGGCTATTTGATGAAACAAACCCAAGATGCGGGGCATGAAGTCGGATTACACTCATGGGATCATCAAGGTTGGCAAGCTAAAGTAGGCCGTTGGTCAACAGAAGAATTAATGCAACAGGTTCGTTTAGGTGTAGAAGCACTGGAAAAAGCACTTGAAAAACCTGTAAAATGTTCTGCGGTTGCTGGGTGGCGTGCTGATGAACGTGTTCTAATGGTTAAAGAAGCTTTCCAATTTGACTACAATAGTGATTGTCGGGGAACGCATCCATTTAGGCCAGTTCTAGAAAATGGTTCTATCGGTACAGTGCAAATTCCAGTAACATTACCAACTTATGATGAAGTGGTCGGTACTAAGGTAAAGGACGAAGATTTTAATCAATTTATTATTGATGAAATCAAAAAAGATCAGGGTATACCTGTTTATACTATTCATACCGAAGTTGAGGGAATGTCAAAAGCGGCTCAATTTGAGCAGTTATTGGCAATGATTGCAAACGAAGGCATCGAATTCTGTCCATTAAGCCATCTACTACCACAAGATATAGACATGCTTCCGATGGGTAAAGTTGTCCGATCTGACTTTCCAGGTCGAGAAGGCTGGTTAGGGTGCCAACAAGAGGTCTAACAAAACTATGTTGAATAACCGGGCGAGTAAAATCGGGGCCATCCTCTTGG