Homologs in group_3123

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20120 FBDBKF_20120 83.9 Morganella morganii S1 hxlR DNA-binding transcriptional regulator, HxlR family
EHELCC_19345 EHELCC_19345 83.9 Morganella morganii S2 hxlR DNA-binding transcriptional regulator, HxlR family
NLDBIP_19475 NLDBIP_19475 83.9 Morganella morganii S4 hxlR DNA-binding transcriptional regulator, HxlR family
LHKJJB_19475 LHKJJB_19475 83.9 Morganella morganii S3 hxlR DNA-binding transcriptional regulator, HxlR family
HKOGLL_19355 HKOGLL_19355 83.9 Morganella morganii S5 hxlR DNA-binding transcriptional regulator, HxlR family

Distribution of the homologs in the orthogroup group_3123

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3123

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACN3 2.17e-71 212 78 0 119 4 ytfH Uncharacterized HTH-type transcriptional regulator YtfH Shigella flexneri
P0ACN2 2.17e-71 212 78 0 119 4 ytfH Uncharacterized HTH-type transcriptional regulator YtfH Escherichia coli (strain K12)
O27346 2.56e-18 77 38 0 90 4 MTH_1285 Uncharacterized HTH-type transcriptional regulator MTH_1285 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q93K57 2.81e-17 74 39 1 96 4 malR Putative regulatory protein MalR Fusobacterium mortiferum
O34533 5.4e-16 71 40 0 84 1 ytcD Uncharacterized HTH-type transcriptional regulator YtcD Bacillus subtilis (strain 168)
P96673 1.29e-15 70 36 0 92 4 ydeP Uncharacterized HTH-type transcriptional regulator YdeP Bacillus subtilis (strain 168)
P42406 1.39e-15 70 40 1 92 1 hxlR HTH-type transcriptional activator HxlR Bacillus subtilis (strain 168)
P37486 8.15e-15 68 34 0 94 1 yybR Uncharacterized HTH-type transcriptional regulator YybR Bacillus subtilis (strain 168)
O31679 1.47e-14 67 42 1 87 4 ykvN Uncharacterized HTH-type transcriptional regulator YkvN Bacillus subtilis (strain 168)
Q9Z9W1 2.46e-14 67 40 1 90 4 BH0655 Uncharacterized HTH-type transcriptional regulator BH0655 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P72979 4.72e-14 67 38 1 96 4 sll1512 Uncharacterized HTH-type transcriptional regulator sll1512 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O32238 5.65e-12 60 35 1 94 4 yvaP Uncharacterized HTH-type transcriptional regulator YvaP Bacillus subtilis (strain 168)
O31494 6.33e-10 55 34 1 94 4 ydzF Uncharacterized HTH-type transcriptional regulator YdzF Bacillus subtilis (strain 168)
O34844 1.95e-09 54 32 1 93 1 yodB HTH-type transcriptional regulator YodB Bacillus subtilis (strain 168)
P0A649 7.08e-08 51 32 3 115 4 BQ2027_MB3122 Uncharacterized HTH-type transcriptional regulator Mb3122 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WMG3 7.08e-08 51 32 3 115 1 Rv3095 Uncharacterized HTH-type transcriptional regulator Rv3095 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMG2 8.99e-08 51 32 3 115 4 MT3179 Uncharacterized HTH-type transcriptional regulator MT3179 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS04760
Feature type CDS
Gene -
Product helix-turn-helix domain-containing protein
Location 1047678 - 1048052 (strand: -1)
Length 375 (nucleotides) / 124 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3123
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF01638 HxlR-like helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1733 Transcription (K) K DNA-binding transcriptional regulator, HxlR family

Protein Sequence

MTISTLSQQLREGNLFSKQCPSREILKHVTSRWGILILIALRDGTHRFSDLRRKIGGVSEKMLSQSLQVLEQDGFINRVSYPVVPPHVEYSLTDLGEQISEKLTLLADWIEINLPNILSRQEVE

Flanking regions ( +/- flanking 50bp)

TAGCACCTAAACTTACTAAAAGTAAGTACATACAAAAAGGTAAGTATACAATGACAATATCCACACTCTCGCAGCAATTACGTGAAGGAAATTTATTTTCTAAACAGTGCCCATCCAGAGAGATCCTCAAACATGTTACAAGTCGTTGGGGCATACTCATTTTAATAGCCCTACGAGATGGAACACATCGTTTTAGTGATTTACGACGTAAAATTGGCGGAGTAAGTGAGAAAATGCTGTCTCAATCGTTACAAGTATTGGAGCAAGATGGTTTTATTAACCGAGTGTCATATCCTGTTGTTCCACCCCATGTAGAGTACTCTTTGACAGATCTTGGTGAGCAAATAAGTGAGAAACTCACGCTTCTTGCGGATTGGATAGAAATAAATTTACCTAATATCTTGTCACGACAAGAAGTGGAGTAGTATACAGATATTATTTCTAATAATTATGTATTTATACTTTAGTTAATAAT