Homologs in group_1973

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14450 FBDBKF_14450 36.2 Morganella morganii S1 - Transposase
EHELCC_07830 EHELCC_07830 36.2 Morganella morganii S2 - Transposase
NLDBIP_08155 NLDBIP_08155 36.2 Morganella morganii S4 - Transposase
LHKJJB_06110 LHKJJB_06110 36.2 Morganella morganii S3 - Transposase
HKOGLL_04805 HKOGLL_04805 36.2 Morganella morganii S5 - Transposase
PMI_RS01530 PMI_RS01530 80.8 Proteus mirabilis HI4320 - transposase

Distribution of the homologs in the orthogroup group_1973

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1973

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS04730
Feature type CDS
Gene -
Product transposase
Location 1041069 - 1041227 (strand: -1)
Length 159 (nucleotides) / 52 (amino acids)
In genomic island GI56

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1973
Orthogroup size 7
N. genomes 6

Actions

Genomic region

Domains

PF01527 Transposase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2963 Mobilome: prophages, transposons (X) X Transposase InsE and inactivated derivatives

Protein Sequence

MKKRTNSVYTTGFKQEAVALVSEQGYSAPKAAGFLGITDKLLYSWKAKLDAE

Flanking regions ( +/- flanking 50bp)

CAAACAGGGCTCTTTAATAATGGAATATAATCTAACTATTGAAGTGTTAAATGAAAAAACGAACAAACAGTGTTTATACTACTGGATTTAAGCAAGAAGCGGTCGCATTAGTCAGCGAACAAGGTTATAGCGCTCCAAAAGCGGCAGGTTTTTTAGGGATCACCGATAAATTACTTTATAGCTGGAAAGCAAAATTAGACGCTGAGTAATCAGGTAACAACTTGAACGCCAAAAATTAGATAAAAATCGTGATTTAATT