Homologs in group_4866

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4866

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4866

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACH4 1.84e-27 98 65 0 72 3 sfsB Sugar fermentation stimulation protein B Shigella flexneri
P0ACH1 1.84e-27 98 65 0 72 3 sfsB Sugar fermentation stimulation protein B Escherichia coli (strain K12)
P0ACH2 1.84e-27 98 65 0 72 3 sfsB Sugar fermentation stimulation protein B Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACH3 1.84e-27 98 65 0 72 3 sfsB Sugar fermentation stimulation protein B Escherichia coli O157:H7
P06020 8.54e-20 78 54 0 64 1 ner Negative regulator of transcription Escherichia phage Mu
P06903 1.25e-18 75 53 0 64 2 ner Negative regulator of transcription Escherichia phage D108
P46496 1.99e-11 57 36 0 66 3 nlp Mu-like prophage FluMu DNA-binding protein Ner Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS04690
Feature type CDS
Gene -
Product helix-turn-helix transcriptional regulator
Location 1034308 - 1034580 (strand: -1)
Length 273 (nucleotides) / 90 (amino acids)
In genomic island GI56

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_4866
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF13693 Winged helix-turn-helix DNA-binding

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3423 Transcription (K) K Predicted transcriptional regulator, lambda repressor-like DNA-binding domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07724 Ner family transcriptional regulator - -

Protein Sequence

MINKNWHPADIIASLKKKGTTLAEVSRAAGLSSSTLSNALSRPWPKGEQIIAKELDIPPSTIWPERYFDEKGNQIIRKLRHKNINNKDEL

Flanking regions ( +/- flanking 50bp)

AACATTTTACTTTCATCAATATACTTTAAACCAATCTATATGGATATCTTATGATTAATAAAAACTGGCATCCGGCTGATATTATTGCTTCTTTAAAGAAAAAAGGGACAACACTAGCAGAAGTTTCCAGAGCTGCAGGTTTAAGCTCATCGACTCTATCTAACGCGTTGTCCCGTCCATGGCCAAAAGGAGAACAAATTATTGCTAAAGAACTTGATATACCTCCATCAACAATATGGCCTGAACGGTACTTTGATGAAAAAGGAAATCAAATTATTCGTAAATTAAGACATAAAAATATAAATAATAAAGATGAATTATAAGCTTATTACTTATTATATTTTTCACGATATAATTTCATTATATCTTCCGC