Homologs in group_107

Help

10 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00185 FBDBKF_00185 43.8 Morganella morganii S1 - Phage antitermination protein Q
FBDBKF_12355 FBDBKF_12355 39.4 Morganella morganii S1 - Antitermination protein Q
FBDBKF_12850 FBDBKF_12850 29.0 Morganella morganii S1 - Phage antitermination protein Q
EHELCC_01360 EHELCC_01360 43.8 Morganella morganii S2 - Phage antitermination protein Q
NLDBIP_02100 NLDBIP_02100 43.8 Morganella morganii S4 - Phage antitermination protein Q
LHKJJB_03615 LHKJJB_03615 43.8 Morganella morganii S3 - Phage antitermination protein Q
HKOGLL_03430 HKOGLL_03430 43.8 Morganella morganii S5 - Phage antitermination protein Q
F4V73_RS06180 F4V73_RS06180 25.2 Morganella psychrotolerans - antiterminator Q family protein
PMI_RS04675 PMI_RS04675 38.3 Proteus mirabilis HI4320 - antiterminator Q family protein
PMI_RS04845 PMI_RS04845 22.0 Proteus mirabilis HI4320 - antiterminator Q family protein

Distribution of the homologs in the orthogroup group_107

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_107

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q47274 5.8e-35 120 49 0 123 3 quuD Prophage antitermination protein Q homolog QuuD Escherichia coli (strain K12)
O48429 8e-34 118 45 0 125 3 Q Antitermination protein Q Enterobacteria phage H19B
P68923 4.52e-33 116 44 0 126 3 Q Antitermination protein Q Enterobacteria phage VT2-Sa
P68922 4.52e-33 116 44 0 126 3 Q Antitermination protein Q Escherichia phage 933W
Q9T1U3 5.21e-32 113 44 1 127 3 5 Probable antitermination protein Q Acyrthosiphon pisum secondary endosymbiont phage 1

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS04475
Feature type CDS
Gene -
Product antiterminator Q family protein
Location 995439 - 995837 (strand: 1)
Length 399 (nucleotides) / 132 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_107
Orthogroup size 11
N. genomes 7

Actions

Genomic region

Domains

PF06530 Phage antitermination protein Q

Protein Sequence

MRDMQEVLSRWGAWSANEGNSIDYSSIAAGFKGLIPSSRRSREQCSDDDGLKINKAVLHLKVNNSYLFQLVIMYYVKNYPLRSMASKLGISHNEVAKRLQTAEGFIEGCLSVDNVKLDMDKIIRKHSIYSLV

Flanking regions ( +/- flanking 50bp)

TAGGAATGGGGGCATTGGTTTAACGTGTATACGGCACGGGGAGTATTAGTATGAGAGATATGCAGGAAGTTTTATCACGTTGGGGTGCGTGGTCAGCTAATGAGGGAAATAGTATCGATTACTCATCAATTGCCGCAGGTTTTAAAGGATTAATTCCAAGTTCAAGACGAAGCCGAGAGCAATGTTCTGATGATGATGGCTTAAAAATAAATAAAGCGGTATTACATTTAAAGGTAAATAATAGTTACTTGTTTCAGTTGGTTATTATGTACTATGTGAAGAATTATCCTTTACGCTCAATGGCTTCAAAACTTGGCATTTCTCATAATGAAGTGGCTAAGCGATTGCAGACAGCAGAAGGATTTATTGAGGGGTGTCTATCGGTTGATAACGTAAAATTAGATATGGATAAAATAATTAGAAAACACAGCATTTATAGTCTTGTGTAATTACAAAACACAATATATTGTGTTAATAATGATTTTGATGTTACATGACT