Homologs in group_899

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04720 FBDBKF_04720 71.2 Morganella morganii S1 lysR DNA-binding transcriptional regulator, LysR family
EHELCC_06010 EHELCC_06010 71.2 Morganella morganii S2 lysR DNA-binding transcriptional regulator, LysR family
NLDBIP_06330 NLDBIP_06330 71.2 Morganella morganii S4 lysR DNA-binding transcriptional regulator, LysR family
LHKJJB_03210 LHKJJB_03210 71.2 Morganella morganii S3 lysR DNA-binding transcriptional regulator, LysR family
HKOGLL_06685 HKOGLL_06685 71.2 Morganella morganii S5 lysR DNA-binding transcriptional regulator, LysR family
F4V73_RS09195 F4V73_RS09195 70.6 Morganella psychrotolerans - LysR family transcriptional regulator

Distribution of the homologs in the orthogroup group_899

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_899

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P39592 1.87e-62 202 35 0 284 3 ywbI Uncharacterized HTH-type transcriptional regulator YwbI Bacillus subtilis (strain 168)
P27111 3.86e-42 150 26 1 288 1 cynR HTH-type transcriptional regulator CynR Escherichia coli (strain K12)
Q8X4M5 3.86e-42 150 27 1 288 3 cynR HTH-type transcriptional regulator CynR Escherichia coli O157:H7
P20668 2.9e-36 134 29 1 295 1 gltC Transcriptional dual regulator GltC Bacillus subtilis (strain 168)
O68014 1.84e-35 132 32 6 272 1 benM HTH-type transcriptional regulator BenM Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P71318 1.41e-31 122 28 3 277 3 oxyR Hydrogen peroxide-inducible genes activator Pectobacterium carotovorum subsp. carotovorum
Q9X725 1.91e-31 122 28 3 277 3 oxyR Hydrogen peroxide-inducible genes activator Dickeya chrysanthemi
P44418 5.2e-31 120 27 3 277 3 oxyR Hydrogen peroxide-inducible genes activator Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0ACQ4 5.16e-29 115 27 3 277 1 oxyR DNA-binding transcriptional dual regulator OxyR Escherichia coli (strain K12)
P0ACQ5 5.16e-29 115 27 3 277 3 oxyR Hydrogen peroxide-inducible genes activator Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACQ6 5.16e-29 115 27 3 277 3 oxyR Hydrogen peroxide-inducible genes activator Escherichia coli O157:H7
P94387 2.92e-28 114 26 4 310 3 ycgK Uncharacterized HTH-type transcriptional regulator YcgK Bacillus subtilis (strain 168)
P52666 1.53e-27 111 30 6 282 3 budR HTH-type transcriptional regulator BudR Raoultella terrigena
P07774 9.81e-27 109 28 5 265 1 catM HTH-type transcriptional regulator CatM Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P20667 1.02e-25 106 28 5 253 3 catR HTH-type transcriptional regulator CatR Pseudomonas putida
O35038 1.76e-25 106 28 4 278 3 ytlI HTH-type transcriptional regulator YtlI Bacillus subtilis (strain 168)
P44876 4.84e-25 105 26 6 268 3 HI_0775 Uncharacterized HTH-type transcriptional regulator HI_0775 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P77559 7.04e-25 104 26 4 287 3 ynfL Uncharacterized HTH-type transcriptional regulator YnfL Escherichia coli (strain K12)
P49518 4.23e-24 102 27 5 284 3 rbcR Probable RuBisCO transcriptional regulator Trieres chinensis
O33945 6.24e-24 102 27 4 249 3 None Probable cat1 operon transcriptional activator Acinetobacter lwoffii
Q04778 7.92e-24 101 24 2 254 3 alsR HTH-type transcriptional regulator AlsR Bacillus subtilis (strain 168)
Q47141 1.09e-23 101 25 4 282 1 hcaR Hca operon transcriptional activator HcaR Escherichia coli (strain K12)
A0T0G2 3.14e-23 100 25 4 287 3 rbcR Probable RuBisCO transcriptional regulator Phaeodactylum tricornutum (strain CCAP 1055/1)
P37499 3.68e-23 99 25 3 244 3 yybE Uncharacterized HTH-type transcriptional regulator YybE Bacillus subtilis (strain 168)
Q08597 6.93e-23 99 27 9 293 3 nac Nitrogen assimilation regulatory protein nac Klebsiella aerogenes
A0T0V5 8.77e-23 99 27 5 284 3 rbcR-A Probable RuBisCO transcriptional regulator Thalassiosira pseudonana
P52667 4.61e-22 96 26 4 277 3 estR HTH-type transcriptional regulator EstR Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q85G62 5.71e-22 96 25 6 294 3 rbcR Probable RuBisCO transcriptional regulator Cyanidioschyzon merolae (strain NIES-3377 / 10D)
Q47005 2.58e-21 94 26 4 245 3 nac Nitrogen assimilation regulatory protein nac Escherichia coli (strain K12)
P52696 4.07e-21 94 22 0 288 3 ybhD Uncharacterized HTH-type transcriptional regulator YbhD Escherichia coli (strain K12)
P52677 9.82e-21 93 27 3 240 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium avium
P52678 9.92e-21 93 25 5 297 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium leprae (strain TN)
P23841 2.13e-20 92 27 2 244 3 xapR HTH-type transcriptional regulator XapR Escherichia coli (strain K12)
P51205 2.45e-20 92 25 4 288 3 rbcR Probable RuBisCO transcriptional regulator Porphyra purpurea
Q1XDT2 3.89e-20 91 25 4 288 3 rbcR Probable RuBisCO transcriptional regulator Neopyropia yezoensis
P45105 4e-20 92 27 7 262 3 cysB HTH-type transcriptional regulator CysB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P77744 8.44e-20 90 24 5 273 3 abgR HTH-type transcriptional regulator AbgR Escherichia coli (strain K12)
O87324 1.08e-19 90 26 3 240 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium marinum
Q4G384 1.13e-19 90 25 3 246 3 rbcR Probable RuBisCO transcriptional regulator Emiliania huxleyi
Q6B936 7.96e-19 88 25 4 288 3 rbcR Probable RuBisCO transcriptional regulator Gracilaria tenuistipitata var. liui
P0ACR8 1.36e-18 87 24 2 284 3 yfeR Uncharacterized HTH-type transcriptional regulator YfeR Shigella flexneri
P0ACR7 1.36e-18 87 24 2 284 3 yfeR Uncharacterized HTH-type transcriptional regulator YfeR Escherichia coli (strain K12)
P55181 1.44e-18 87 26 7 249 3 yxjO Uncharacterized HTH-type transcriptional regulator YxjO Bacillus subtilis (strain 168)
P94403 2.36e-18 86 27 6 261 3 bsdA HTH-type transcriptional regulator BsdA Bacillus subtilis (strain 168)
P52693 2.57e-18 86 25 5 276 3 ntcB Probable nitrogen assimilation transcriptional activator Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P52691 2.93e-18 86 28 2 242 3 lrrA Probable HTH-type transcriptional regulator LrrA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P25544 2.98e-18 86 28 3 199 3 rbcR RuBisCO operon transcriptional regulator Allochromatium vinosum
A4QH19 3.09e-18 86 26 6 293 1 shiR HTH-type transcriptional regulator ShiR Corynebacterium glutamicum (strain R)
Q3MCB5 3.13e-18 86 24 4 288 3 rbcR Probable RuBisCO transcriptional regulator Trichormus variabilis (strain ATCC 29413 / PCC 7937)
P48271 3.75e-18 86 25 4 288 3 rbcR Probable RuBisCO transcriptional regulator Cyanophora paradoxa
O32255 4.89e-18 85 21 4 293 3 yvbU Uncharacterized HTH-type transcriptional regulator YvbU Bacillus subtilis (strain 168)
O87883 5.5e-18 83 28 0 176 3 oxyR Probable hydrogen peroxide-inducible genes activator (Fragment) Mycobacterium xenopi
P0A9F3 6.03e-18 85 24 4 267 3 cysB HTH-type transcriptional regulator CysB Escherichia coli (strain K12)
P0A9F4 6.03e-18 85 24 4 267 3 cysB HTH-type transcriptional regulator CysB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9F5 6.03e-18 85 24 4 267 3 cysB HTH-type transcriptional regulator CysB Escherichia coli O157:H7
O32186 7e-18 85 25 2 243 3 yusT Uncharacterized HTH-type transcriptional regulator YusT Bacillus subtilis (strain 168)
P42722 8.02e-18 85 25 4 291 3 cfxR HTH-type transcriptional regulator CfxR Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q57748 8.48e-18 85 27 2 241 3 MJ0300 Uncharacterized HTH-type transcriptional regulator MJ0300 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P45600 1.65e-17 84 24 4 258 1 cysB HTH-type transcriptional regulator CysB Klebsiella pneumoniae
A2CI69 1.67e-17 84 24 6 278 3 rbcR Probable RuBisCO transcriptional regulator Chlorokybus atmophyticus
Q9X5P2 1.73e-17 84 26 3 240 2 oxyR Probable hydrogen peroxide-inducible genes activator Streptomyces viridosporus
P52686 1.96e-17 84 28 2 184 3 sdsB SDS degradation transcriptional activation protein Pseudomonas sp. (strain ATCC 19151)
Q8YQ82 2e-17 84 24 4 288 3 rbcR Probable RuBisCO transcriptional regulator Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P94501 2.31e-17 83 24 4 252 1 gltR HTH-type transcriptional regulator GltR Bacillus subtilis (strain 168)
P73123 6.06e-17 83 24 5 287 3 rbcR Probable RuBisCO transcriptional regulator Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P06614 6.38e-17 82 24 4 260 1 cysB HTH-type transcriptional regulator CysB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P37641 1.13e-16 82 34 0 122 3 yhjC Uncharacterized HTH-type transcriptional regulator YhjC Escherichia coli (strain K12)
B4E8V9 2.09e-16 81 25 4 280 1 cysB HTH-type transcriptional regulator CysB Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
O78432 2.16e-16 81 22 3 288 3 rbcR Probable RuBisCO transcriptional regulator Guillardia theta
P52665 2.64e-16 77 42 0 97 3 budR HTH-type transcriptional regulator BudR (Fragment) Klebsiella aerogenes
O34701 3.44e-16 80 26 5 251 3 yoaU Uncharacterized HTH-type transcriptional regulator YoaU Bacillus subtilis (strain 168)
O19892 5.41e-16 80 23 6 289 3 rbcR Probable RuBisCO transcriptional regulator Cyanidium caldarium
P44821 7.53e-16 79 23 8 291 3 ilvY HTH-type transcriptional activator IlvY Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q05840 1.02e-15 79 25 8 259 3 clcR HTH-type transcriptional regulator ClcR Pseudomonas putida
P39647 2.24e-15 78 26 0 188 1 cysL HTH-type transcriptional regulator CysL Bacillus subtilis (strain 168)
P52684 2.77e-15 78 24 3 268 3 mauR Malonate utilization transcriptional regulator Klebsiella pneumoniae
P52670 5.48e-15 77 24 4 251 3 ilvR HTH-type transcriptional regulator IlvR Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P16400 7.37e-15 76 26 11 302 3 mleR Malolactic fermentation system transcriptional activator Lactococcus lactis subsp. lactis (strain IL1403)
P0A2Q2 5.18e-14 74 26 5 257 3 ilvY HTH-type transcriptional activator IlvY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2Q3 5.18e-14 74 26 5 257 3 ilvY HTH-type transcriptional activator IlvY Salmonella typhi
P70785 5.6e-14 74 24 2 245 3 ttuA HTH-type transcriptional regulator TtuA Agrobacterium vitis
P74422 6.46e-14 74 23 2 247 3 ntcB Probable nitrogen assimilation transcriptional activator Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P39127 7.47e-14 73 20 5 274 3 citR HTH-type transcriptional regulator CitR Bacillus subtilis (strain 168)
Q44311 1.44e-13 72 25 7 248 3 soxR HTH-type transcriptional regulator SoxR Arthrobacter sp. (strain TE1826)
O06703 2.1e-13 72 23 0 240 3 bbuR HTH-type transcriptional regulator BbuR Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P77309 2.92e-13 72 24 5 254 3 yneJ Uncharacterized HTH-type transcriptional regulator YneJ Escherichia coli (strain K12)
P05827 3.54e-13 72 25 5 263 3 ilvY HTH-type transcriptional regulator IlvY Escherichia coli (strain K12)
A7Z5E4 6.5e-13 70 23 4 249 3 yofA HTH-type transcriptional regulator YofA Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P16931 1.02e-12 70 31 1 149 3 dgdR HTH-type transcriptional regulator DgdR Burkholderia cepacia
P96725 1.13e-12 70 27 7 248 3 ywqM Uncharacterized HTH-type transcriptional regulator YwqM Bacillus subtilis (strain 168)
O34685 1.34e-12 70 25 4 244 1 yofA HTH-type transcriptional regulator YofA Bacillus subtilis (strain 168)
Q9I6Z9 1.37e-12 70 28 1 177 3 bauR HTH-type transcriptional activator BauR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q81IX0 1.46e-12 70 23 3 246 3 czcR HTH-type transcriptional regulator CzcR Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q6HPH4 1.8e-12 69 23 3 246 3 czcR HTH-type transcriptional regulator CzcR Bacillus thuringiensis subsp. konkukian (strain 97-27)
A0R8S0 2.07e-12 69 23 3 246 3 czcR HTH-type transcriptional regulator CzcR Bacillus thuringiensis (strain Al Hakam)
Q63H01 2.1e-12 69 23 3 246 3 czcR HTH-type transcriptional regulator CzcR Bacillus cereus (strain ZK / E33L)
Q73EY2 2.1e-12 69 23 3 246 3 czcR HTH-type transcriptional regulator CzcR Bacillus cereus (strain ATCC 10987 / NRS 248)
P52595 2.15e-12 69 26 7 264 3 cbbR HTH-type transcriptional regulator CbbR Rhodospirillum rubrum
P52669 2.66e-12 69 21 3 246 3 ttuA HTH-type transcriptional regulator TtuA Agrobacterium vitis
P52689 3.28e-12 69 30 0 117 3 ltrA Probable HTH-type transcriptional regulator LtrA Klebsiella pneumoniae
Q81VJ1 3.96e-12 68 23 3 246 3 czcR HTH-type transcriptional regulator CzcR Bacillus anthracis
P42427 7.86e-12 67 27 2 145 3 tfdT HTH-type transcriptional regulator TfdT Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
P0A9F6 8.39e-12 68 32 1 122 1 gcvA Glycine cleavage system transcriptional activator Escherichia coli (strain K12)
P0A9F7 8.39e-12 68 32 1 122 3 gcvA Glycine cleavage system transcriptional activator Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9F8 8.39e-12 68 32 1 122 3 gcvA Glycine cleavage system transcriptional activator Escherichia coli O157:H7
Q55459 9.7e-12 67 23 4 186 1 cmpR HTH-type transcriptional activator CmpR Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0A9G1 1.04e-11 67 23 2 255 3 metR HTH-type transcriptional regulator MetR Shigella flexneri
P0A9F9 1.04e-11 67 23 2 255 1 metR HTH-type transcriptional regulator MetR Escherichia coli (strain K12)
P0A9G0 1.04e-11 67 23 2 255 3 metR HTH-type transcriptional regulator MetR Escherichia coli O157:H7
P0ACQ9 1.08e-11 67 22 6 278 3 tdcA HTH-type transcriptional regulator TdcA Shigella flexneri
P0ACQ7 1.08e-11 67 22 6 278 3 tdcA HTH-type transcriptional regulator TdcA Escherichia coli (strain K12)
P0ACQ8 1.08e-11 67 22 6 278 3 tdcA HTH-type transcriptional regulator TdcA Escherichia coli O157:H7
O69055 1.74e-11 65 25 3 186 3 ptxE Putative HTH-type transcriptional regulator protein PtxE (Fragment) Stutzerimonas stutzeri
P52661 2.79e-11 66 21 6 266 1 gbpR HTH-type transcriptional regulator GbpR Azospirillum brasilense
P03030 4.81e-11 65 23 3 263 3 lysR Transcriptional activator protein LysR Escherichia coli (strain K12)
Q5N5I5 1.04e-10 65 22 2 194 3 cmpR HTH-type transcriptional activator CmpR Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q9F1R2 1.04e-10 65 22 2 194 1 cmpR HTH-type transcriptional activator CmpR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A5F9F9 1.08e-10 64 23 7 254 3 irgB Iron-regulated virulence regulatory protein IrgB Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P56885 1.13e-10 64 25 2 193 3 cbbR HTH-type transcriptional regulator CbbR Sinorhizobium medicae (strain WSM419)
P0C6D1 1.16e-10 64 23 7 254 3 irgB Iron-regulated virulence regulatory protein IrgB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P0A2Q4 1.51e-10 64 23 2 255 3 metR HTH-type transcriptional regulator MetR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2Q5 1.51e-10 64 23 2 255 3 metR HTH-type transcriptional regulator MetR Salmonella typhi
P71025 2.03e-10 63 24 4 250 3 czcR HTH-type transcriptional regulator CzcR Bacillus subtilis (strain 168)
Q8KA72 2.55e-10 63 26 9 264 3 metR HTH-type transcriptional regulator MetR Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P0ACR0 2.71e-10 63 26 9 283 1 allS HTH-type transcriptional activator AllS Escherichia coli (strain K12)
P0ACR1 2.71e-10 63 26 9 283 3 allS HTH-type transcriptional activator AllS Escherichia coli O157:H7
Q9JXW7 2.78e-10 63 32 2 121 1 crgA HTH-type transcriptional regulator CrgA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JPU9 3.79e-10 63 32 2 121 1 crgA HTH-type transcriptional regulator CrgA Neisseria meningitidis serogroup C (strain 8013)
O34827 3.92e-10 63 20 8 288 3 ykuM Uncharacterized HTH-type transcriptional regulator YkuM Bacillus subtilis (strain 168)
P58332 4.42e-10 63 26 2 190 3 cbbR HTH-type transcriptional regulator CbbR Rhizobium meliloti (strain 1021)
P0A2Q0 6.29e-10 62 36 0 80 3 hdfR HTH-type transcriptional regulator HdfR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2Q1 6.29e-10 62 36 0 80 3 hdfR HTH-type transcriptional regulator HdfR Salmonella typhi
B5BIR0 6.29e-10 62 36 0 80 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi A (strain AKU_12601)
C0Q2U0 6.29e-10 62 36 0 80 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi C (strain RKS4594)
A9MXD5 6.29e-10 62 36 0 80 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJZ0 6.29e-10 62 36 0 80 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TAZ8 6.29e-10 62 36 0 80 3 hdfR HTH-type transcriptional regulator HdfR Salmonella heidelberg (strain SL476)
B5EZ22 6.29e-10 62 36 0 80 3 hdfR HTH-type transcriptional regulator HdfR Salmonella agona (strain SL483)
B4SYF7 6.41e-10 62 36 0 80 3 hdfR HTH-type transcriptional regulator HdfR Salmonella newport (strain SL254)
B5FN59 6.41e-10 62 36 0 80 3 hdfR HTH-type transcriptional regulator HdfR Salmonella dublin (strain CT_02021853)
B4TNR5 6.66e-10 62 36 0 80 3 hdfR HTH-type transcriptional regulator HdfR Salmonella schwarzengrund (strain CVM19633)
A0A0H2ZDG9 7.14e-10 62 30 0 116 3 PA14_22550 HTH-type transcriptional repressor PA14_22550 Pseudomonas aeruginosa (strain UCBPP-PA14)
P77171 8.21e-10 62 27 4 183 3 ydcI Uncharacterized HTH-type transcriptional regulator YdcI Escherichia coli (strain K12)
Q329U3 1.06e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Shigella dysenteriae serotype 1 (strain Sd197)
B6I4A0 1.06e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain SE11)
B7M5B2 1.06e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O8 (strain IAI1)
B5YY14 1.06e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XAW1 1.06e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O157:H7
B7L8A6 1.06e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain 55989 / EAEC)
A7ZTW7 1.06e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O139:H28 (strain E24377A / ETEC)
B7LUJ5 1.07e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7NU32 1.1e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q3YVK2 1.11e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Shigella sonnei (strain Ss046)
P0A8S0 1.11e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Shigella flexneri
Q0SYV7 1.11e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Shigella flexneri serotype 5b (strain 8401)
Q31UM0 1.11e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Shigella boydii serotype 4 (strain Sb227)
Q1R4H3 1.11e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain UTI89 / UPEC)
B1LLU0 1.11e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain SMS-3-5 / SECEC)
B7NF72 1.11e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8R9 1.11e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain K12)
B1IWY2 1.11e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P59369 1.11e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAV4 1.11e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A6M0 1.11e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O9:H4 (strain HS)
B1X9Y2 1.11e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain K12 / DH10B)
C4ZZ35 1.11e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain K12 / MC4100 / BW2952)
B7N260 1.11e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O81 (strain ED1a)
B7MGH6 1.11e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UMM1 1.11e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B4E8S9 1.14e-09 61 22 4 244 1 ssuR HTH-type transcriptional regulator SsuR Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
B2TU26 1.17e-09 61 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P52675 1.41e-09 58 30 2 136 3 cysB HTH-type transcriptional regulator CysB (Fragment) Thiocapsa roseopersicina
P0DUU5 1.68e-09 61 23 9 282 1 aceR HTH-type transcriptional regulator AceR Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
P14145 1.88e-09 60 31 4 132 3 ampR HTH-type transcriptional activator AmpR Rhodobacter capsulatus
Q46M54 1.91e-09 60 25 8 258 1 tfdS HTH-type transcriptional regulator TfdS Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q46M57 1.96e-09 60 25 8 258 1 tfdR HTH-type transcriptional regulator TdfR Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
P96194 2.23e-09 58 35 0 96 3 None Uncharacterized HTH-type transcriptional regulator in ibpB-leuC intergenic region Azotobacter vinelandii
P37459 2.24e-09 60 28 0 114 3 sinR Probable HTH-type transcriptional regulator SinR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8FK66 2.28e-09 60 26 9 283 3 allS HTH-type transcriptional activator AllS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TKD7 2.28e-09 60 26 9 283 3 allS HTH-type transcriptional activator AllS Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q1R6S1 2.42e-09 60 29 1 128 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli (strain UTI89 / UPEC)
Q8FDH0 2.42e-09 60 29 1 128 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TD46 2.44e-09 60 29 1 128 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1JI47 2.54e-09 60 35 0 80 3 hdfR HTH-type transcriptional regulator HdfR Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P45463 2.56e-09 60 29 1 128 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli (strain K12)
Q1RF30 2.58e-09 60 26 9 283 3 allS HTH-type transcriptional activator AllS Escherichia coli (strain UTI89 / UPEC)
A1A8H0 2.58e-09 60 26 9 283 3 allS HTH-type transcriptional activator AllS Escherichia coli O1:K1 / APEC
Q8XBK9 2.81e-09 60 29 1 128 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli O157:H7
P94678 3.4e-09 60 22 6 271 1 tsaR HTH-type transcriptional regulator TsaR Comamonas testosteroni
B1JQ39 3.94e-09 60 36 0 80 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66G51 3.94e-09 60 36 0 80 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRF4 3.94e-09 60 36 0 80 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis (strain Pestoides F)
Q1CNN4 3.94e-09 60 36 0 80 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis bv. Antiqua (strain Nepal516)
A9R8E7 3.94e-09 60 36 0 80 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis bv. Antiqua (strain Angola)
Q8ZAA7 3.94e-09 60 36 0 80 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis
B2JZG4 3.94e-09 60 36 0 80 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CBT5 3.94e-09 60 36 0 80 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis bv. Antiqua (strain Antiqua)
A7FD20 3.94e-09 60 36 0 80 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q9HWH8 4.96e-09 59 22 6 266 3 nmoR HTH-type transcriptional regulator NmoR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q57S50 5.06e-09 60 26 9 280 3 allS HTH-type transcriptional activator AllS Salmonella choleraesuis (strain SC-B67)
P30864 8.6e-09 58 29 0 119 3 yafC Uncharacterized HTH-type transcriptional regulator YafC Escherichia coli (strain K12)
Q9S4Y7 1.25e-08 58 26 9 280 3 allS HTH-type transcriptional activator AllS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PCH2 1.25e-08 58 26 9 280 3 allS HTH-type transcriptional activator AllS Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P46068 1.38e-08 58 31 1 108 2 dsdC HTH-type transcriptional regulator DsdC Escherichia coli (strain K12)
O07906 1.64e-08 58 20 3 225 3 yraN Uncharacterized HTH-type transcriptional regulator YraN Bacillus subtilis (strain 168)
Q88JX7 1.84e-08 58 27 5 169 3 galR HTH-type transcriptional regulator GalR Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q88JX7 1.03e-05 50 22 2 176 3 galR HTH-type transcriptional regulator GalR Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P0A4T7 2.17e-08 57 26 0 121 3 pcaQ HTH-type transcriptional regulator PcaQ Rhizobium radiobacter
P0A4T6 2.17e-08 57 26 0 121 3 pcaQ HTH-type transcriptional regulator PcaQ Agrobacterium fabrum (strain C58 / ATCC 33970)
P75836 3.06e-08 57 29 0 116 3 ycaN Uncharacterized HTH-type transcriptional regulator YcaN Escherichia coli (strain K12)
Q47083 3.9e-08 57 24 4 228 1 cbl HTH-type transcriptional regulator cbl Escherichia coli (strain K12)
Q765S2 4.16e-08 56 23 6 253 3 allS HTH-type transcriptional activator AllS Klebsiella pneumoniae
Q8Z8R3 5.48e-08 56 26 9 280 3 allS HTH-type transcriptional activator AllS Salmonella typhi
P67662 8.5e-08 56 25 0 122 3 aaeR HTH-type transcriptional activator AaeR Escherichia coli (strain K12)
P67663 8.5e-08 56 25 0 122 3 aaeR HTH-type transcriptional activator AaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P67664 8.5e-08 56 25 0 122 3 aaeR HTH-type transcriptional activator AaeR Escherichia coli O157:H7
P27102 1.1e-07 55 27 4 177 3 tcbR HTH-type transcriptional regulator TcbR Pseudomonas sp. (strain P51)
P52662 1.24e-07 55 26 7 245 3 pecT HTH-type transcriptional regulator PecT Dickeya dadantii (strain 3937)
P42507 1.64e-07 55 30 2 125 3 hvrB AhcY transcriptional activator HvrB Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P35112 1.66e-07 55 28 0 119 3 nocR Regulatory protein NocR Agrobacterium tumefaciens (strain T37)
Q00678 1.7e-07 55 28 0 119 3 nocR Regulatory protein NocR Agrobacterium fabrum (strain C58 / ATCC 33970)
P45099 1.76e-07 55 23 7 223 3 gcvA Glycine cleavage system transcriptional activator homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P10183 2.55e-07 54 24 5 200 3 nahR HTH-type transcriptional activator NahR Pseudomonas putida
P33634 2.89e-07 54 23 7 277 3 yfiE Uncharacterized HTH-type transcriptional regulator YfiE Escherichia coli (strain K12)
P34818 4.86e-07 53 43 0 62 3 trpI HTH-type transcriptional regulator TrpI Pseudomonas syringae pv. syringae
P0A4T3 6.46e-07 53 22 1 192 1 occR Octopine catabolism/uptake operon regulatory protein OccR Rhizobium radiobacter
P0A4T4 6.46e-07 53 22 1 192 1 occR Octopine catabolism/uptake operon regulatory protein OccR Agrobacterium tumefaciens (strain Ach5)
Q9EXL7 9.63e-07 52 23 5 182 3 nagR HTH-type transcriptional activator NagR Ralstonia sp.
P52659 1.48e-06 52 34 0 86 3 abaB HTH-type transcriptional regulator AbaB Streptomyces antibioticus
P0ACR4 1.51e-06 52 21 2 193 1 yeiE Uncharacterized HTH-type transcriptional regulator YeiE Escherichia coli (strain K12)
P0ACR5 1.51e-06 52 21 2 193 3 yeiE Uncharacterized HTH-type transcriptional regulator YeiE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACR6 1.51e-06 52 21 2 193 3 yeiE Uncharacterized HTH-type transcriptional regulator YeiE Escherichia coli O157:H7
O33812 1.9e-06 52 20 3 255 3 None Uncharacterized HTH-type transcriptional regulator in lacR 5'region (Fragment) Staphylococcus xylosus
P39376 3.28e-06 51 23 3 176 1 yjiE HTH-type transcriptional regulator YjiE Escherichia coli (strain K12)
Q9HW38 3.33e-06 51 30 5 150 3 argP HTH-type transcriptional regulator ArgP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02H78 3.33e-06 51 30 5 150 3 argP HTH-type transcriptional regulator ArgP Pseudomonas aeruginosa (strain UCBPP-PA14)
P11720 5.8e-06 50 26 2 124 1 trpI HTH-type transcriptional regulator TrpI Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P72294 7.22e-06 50 21 2 237 3 occR Octopine catabolism/uptake operon regulatory protein OccR Rhizobium meliloti
P0DV33 9.31e-06 50 25 2 163 1 admX HTH-type transcriptional regulator AdmX Serratia plymuthica
P76250 1.1e-05 49 33 0 90 1 dmlR HTH-type transcriptional regulator DmlR Escherichia coli (strain K12)
P77700 1.34e-05 49 19 2 171 1 yahB Uncharacterized HTH-type transcriptional regulator YahB Escherichia coli (strain K12)
P52658 1.48e-05 49 27 1 124 3 ampR HTH-type transcriptional activator AmpR Citrobacter koseri
P43160 2.84e-05 48 20 6 281 3 mprR Small neutral protease regulatory protein Streptomyces coelicolor
P52660 3.49e-05 48 35 0 65 3 blaA HTH-type transcriptional regulator BlaA Proteus vulgaris
A7MR91 3.9e-05 48 40 1 70 3 argP HTH-type transcriptional regulator ArgP Cronobacter sakazakii (strain ATCC BAA-894)
Q8VWE6 3.99e-05 48 25 6 249 3 lrhA Probable HTH-type transcriptional regulator LrhA Escherichia coli O157:H7
P0ACR2 4.07e-05 48 24 5 195 3 ydhB Uncharacterized HTH-type transcriptional regulator YdhB Escherichia coli (strain K12)
P0ACR3 4.07e-05 48 24 5 195 3 ydhB Uncharacterized HTH-type transcriptional regulator YdhB Escherichia coli O157:H7
Q57083 4.15e-05 47 27 3 126 1 perR HTH-type transcriptional regulator PerR Escherichia coli (strain K12)
P36771 4.87e-05 47 25 6 249 1 lrhA Probable HTH-type transcriptional regulator LrhA Escherichia coli (strain K12)
B7LPC9 5.36e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P58509 5.56e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TV33 5.56e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Salmonella schwarzengrund (strain CVM19633)
B5BFM9 5.56e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Salmonella paratyphi A (strain AKU_12601)
C0PY38 5.56e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Salmonella paratyphi C (strain RKS4594)
A9N3P8 5.56e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJH0 5.56e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T5G4 5.56e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Salmonella newport (strain SL254)
B4THE6 5.56e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Salmonella heidelberg (strain SL476)
Q57K51 5.56e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Salmonella choleraesuis (strain SC-B67)
B5F5I9 5.56e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Salmonella agona (strain SL483)
A9MRG1 5.61e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P58508 5.66e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Salmonella typhi
B5RE25 5.97e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QXJ1 5.97e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Salmonella enteritidis PT4 (strain P125109)
B5FUH7 5.97e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Salmonella dublin (strain CT_02021853)
P72131 6e-05 47 23 7 251 1 ptxR HTH-type transcriptional regulator PtxR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P55576 6.22e-05 47 22 5 206 3 NGR_a02420 Uncharacterized HTH-type transcriptional regulator y4mQ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A6TDS6 6.48e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q3YXV6 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Shigella sonnei (strain Ss046)
P0A8S4 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Shigella flexneri
Q0T0Y4 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Shigella flexneri serotype 5b (strain 8401)
Q32BX8 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Shigella dysenteriae serotype 1 (strain Sd197)
Q31WH5 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Shigella boydii serotype 4 (strain Sb227)
B2U0T2 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R7B4 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Escherichia coli (strain UTI89 / UPEC)
B1LDC0 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Escherichia coli (strain SMS-3-5 / SECEC)
B6I748 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Escherichia coli (strain SE11)
B7N7G1 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8S1 6.6e-05 47 40 1 70 1 argP HTH-type transcriptional regulator ArgP Escherichia coli (strain K12)
B1IT87 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A8S2 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TDT7 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A456 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Escherichia coli O9:H4 (strain HS)
B1XEK1 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Escherichia coli (strain K12 / DH10B)
C5A0I6 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Escherichia coli (strain K12 / MC4100 / BW2952)
B7LYT3 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Escherichia coli O8 (strain IAI1)
B7MZ67 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Escherichia coli O81 (strain ED1a)
B7NHX5 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YQA9 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8S3 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Escherichia coli O157:H7
B7LFH3 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Escherichia coli (strain 55989 / EAEC)
B7MMA1 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UHW2 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZR24 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Escherichia coli O139:H28 (strain E24377A / ETEC)
A8APC5 6.6e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5XUC3 6.66e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Klebsiella pneumoniae (strain 342)
A4WE66 7.16e-05 47 40 1 70 3 argP HTH-type transcriptional regulator ArgP Enterobacter sp. (strain 638)
Q4K779 0.000104 46 31 3 119 3 argP HTH-type transcriptional regulator ArgP Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
O52399 0.000111 46 37 3 96 3 argP HTH-type transcriptional regulator ArgP Edwardsiella ictaluri (strain 93-146)
Q7N185 0.000114 46 47 0 51 3 argP HTH-type transcriptional regulator ArgP Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B2VF18 0.000116 46 47 0 51 3 argP HTH-type transcriptional regulator ArgP Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B4F0Q1 0.000117 46 47 0 51 3 argP HTH-type transcriptional regulator ArgP Proteus mirabilis (strain HI4320)
P77333 0.000123 46 25 0 116 1 pgrR HTH-type transcriptional regulator PgrR Escherichia coli (strain K12)
A1JPP6 0.000138 46 47 0 51 3 argP HTH-type transcriptional regulator ArgP Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GIT0 0.000149 46 47 0 51 3 argP HTH-type transcriptional regulator ArgP Serratia proteamaculans (strain 568)
B1JNR6 0.000169 46 47 0 51 3 argP HTH-type transcriptional regulator ArgP Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q666Q6 0.000169 46 47 0 51 3 argP HTH-type transcriptional regulator ArgP Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TI95 0.000169 46 47 0 51 3 argP HTH-type transcriptional regulator ArgP Yersinia pestis (strain Pestoides F)
Q1CEY8 0.000169 46 47 0 51 3 argP HTH-type transcriptional regulator ArgP Yersinia pestis bv. Antiqua (strain Nepal516)
A9R4J7 0.000169 46 47 0 51 3 argP HTH-type transcriptional regulator ArgP Yersinia pestis bv. Antiqua (strain Angola)
P58510 0.000169 46 47 0 51 3 argP HTH-type transcriptional regulator ArgP Yersinia pestis
B2K0R5 0.000169 46 47 0 51 3 argP HTH-type transcriptional regulator ArgP Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CB53 0.000169 46 47 0 51 3 argP HTH-type transcriptional regulator ArgP Yersinia pestis bv. Antiqua (strain Antiqua)
A7FF10 0.000169 46 47 0 51 3 argP HTH-type transcriptional regulator ArgP Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P52676 0.000183 45 26 2 126 3 nmcR Carbapenem-hydrolyzing beta-lactamase transcriptional activator Enterobacter cloacae
C6DF35 0.000217 45 45 0 51 3 argP HTH-type transcriptional regulator ArgP Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D092 0.000227 45 45 0 51 3 argP HTH-type transcriptional regulator ArgP Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2NRD9 0.000232 45 35 2 94 3 argP HTH-type transcriptional regulator ArgP Sodalis glossinidius (strain morsitans)
P24734 0.000289 45 26 3 131 1 ampR HTH-type transcriptional activator AmpR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P70773 0.00045 44 39 1 71 3 argP HTH-type transcriptional regulator ArgP Aeromonas salmonicida
C3LRZ9 0.000599 44 45 0 51 3 argP HTH-type transcriptional regulator ArgP Vibrio cholerae serotype O1 (strain M66-2)
Q9KUN3 0.000599 44 45 0 51 3 argP HTH-type transcriptional regulator ArgP Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F9F1 0.00061 44 45 0 51 3 argP HTH-type transcriptional regulator ArgP Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P52698 0.000624 44 19 4 200 3 phcA HTH-type transcriptional regulator PhcA Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
P67668 0.000789 43 28 0 76 3 BQ2027_MB2303C Uncharacterized HTH-type transcriptional regulator Mb2303c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WMF3 0.000789 43 28 0 76 1 Rv2282c Uncharacterized HTH-type transcriptional regulator Rv2282c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMF2 0.000789 43 28 0 76 3 MT2340 Uncharacterized HTH-type transcriptional regulator MT2340 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS04155
Feature type CDS
Gene -
Product LysR family transcriptional regulator
Location 934339 - 935232 (strand: 1)
Length 894 (nucleotides) / 297 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_899
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00126 Bacterial regulatory helix-turn-helix protein, lysR family
PF03466 LysR substrate binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0583 Transcription (K) K DNA-binding transcriptional regulator, LysR family

Protein Sequence

MDIRVLRYFIEVVQLNGFSRAADALFITQPAISRSIKKLEDELGTVLLIREVDGVKLTDDGAILYEHAKQILAQFNSMNKALNDKDEPLTGALNVGLPPVIASTYFADIIMAFSSRHPNVELKIFELGTKQMEDAMLEGTVETAAVMLPFNDKDFELTIFSEDHLMLLVAQSHPLAKDKKVNFKQLITERFIFFSEDFRINDLVRSACGIYNTEPQIVGRSNHLDLIIAMVKAGVGITLLPNSMCNKYPIDDLVVIPITSPRLSYQLALATNQNSYQSRSCQAWNKLAIEKLMKENI

Flanking regions ( +/- flanking 50bp)

GTTTATTATTATTGGGGGTATAACCAAAAGTAATAAGGTAAAAATTATTTATGGATATTCGTGTTTTACGCTATTTTATTGAAGTTGTTCAATTAAATGGATTTAGCCGAGCCGCTGATGCTTTATTTATTACACAACCAGCCATTAGTCGTAGCATTAAAAAATTAGAGGATGAATTAGGCACTGTTTTATTAATAAGAGAAGTGGATGGGGTAAAATTAACTGATGACGGTGCTATTTTATATGAGCATGCAAAGCAGATCCTCGCTCAATTTAATAGTATGAATAAAGCATTAAATGATAAAGATGAACCTTTAACAGGCGCCTTAAATGTCGGATTACCTCCTGTTATAGCCTCAACCTATTTTGCTGATATTATCATGGCGTTTAGCTCTCGCCATCCCAATGTTGAACTTAAAATTTTTGAGCTGGGCACCAAACAGATGGAAGATGCGATGTTAGAAGGCACGGTAGAAACTGCGGCAGTGATGTTACCTTTTAATGATAAAGATTTTGAATTAACCATTTTTTCAGAAGATCACTTGATGTTATTAGTAGCACAATCCCATCCTTTGGCTAAAGATAAGAAGGTTAATTTTAAACAGCTTATTACAGAGCGGTTTATCTTTTTTTCAGAAGATTTTCGTATTAATGATTTGGTACGTAGTGCTTGTGGGATTTATAACACTGAACCACAAATTGTGGGGAGAAGTAATCATTTAGATTTAATTATTGCAATGGTTAAAGCCGGTGTCGGGATCACACTGTTGCCTAATAGCATGTGTAATAAATATCCTATCGATGATTTAGTGGTTATTCCCATTACTTCCCCTAGGTTATCTTATCAATTAGCTTTAGCCACCAATCAAAATAGTTACCAAAGCCGTAGTTGCCAAGCATGGAATAAATTAGCAATAGAGAAATTAATGAAAGAGAATATTTAATCATGGAATGATAAATACGCTTTGTAAAAAGCGTTTTATTAATGGTAGCT