Homologs in group_3850

Help

1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
F4V73_RS10235 F4V73_RS10235 78.7 Morganella psychrotolerans dkgB 2,5-didehydrogluconate reductase DkgB

Distribution of the homologs in the orthogroup group_3850

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3850

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8X7Z7 2.26e-165 461 82 0 267 3 dkgB 2,5-diketo-D-gluconic acid reductase B Escherichia coli O157:H7
P30863 8.99e-165 459 82 0 267 1 dkgB 2,5-diketo-D-gluconic acid reductase B Escherichia coli (strain K12)
Q8ZRM7 1.57e-164 459 81 0 267 3 dkgB 2,5-diketo-D-gluconic acid reductase B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z988 1.81e-163 456 80 0 267 3 dkgB 2,5-diketo-D-gluconic acid reductase B Salmonella typhi
Q8ZH36 1.57e-139 395 71 0 267 3 dkgB 2,5-diketo-D-gluconic acid reductase B Yersinia pestis
Q8ZI40 1.36e-56 185 40 5 256 3 dkgA 2,5-diketo-D-gluconic acid reductase A Yersinia pestis
P06632 1.97e-53 177 42 4 257 1 dkgA 2,5-diketo-D-gluconic acid reductase A Corynebacterium sp. (strain ATCC 31090)
Q4DJ07 8.85e-52 173 34 5 269 1 Tc00.1047053511287.49 9,11-endoperoxide prostaglandin H2 reductase Trypanosoma cruzi (strain CL Brener)
Q46857 1.85e-51 172 37 5 256 1 dkgA 2,5-diketo-D-gluconic acid reductase A Escherichia coli (strain K12)
Q8XBT6 5.72e-51 171 37 5 256 3 dkgA 2,5-diketo-D-gluconic acid reductase A Escherichia coli O157:H7
A4TE41 2.98e-50 169 37 2 255 3 Mflv_4205 Aldo-keto reductase Mflv_4205 Mycolicibacterium gilvum (strain PYR-GCK)
B2HIJ9 8.39e-50 168 39 2 255 3 MMAR_1744 Aldo-keto reductase MMAR_1744 Mycobacterium marinum (strain ATCC BAA-535 / M)
P23901 1.95e-49 168 33 7 280 1 None Aldose reductase Hordeum vulgare
Q8SSK6 2.01e-49 167 37 11 295 1 ECU01_0970 Aldose reductase Encephalitozoon cuniculi (strain GB-M1)
Q7TXI6 2.32e-49 167 37 2 255 1 BQ2027_MB2996 Aldo-keto reductase BQ2027_MB2996 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A1KMW6 2.32e-49 167 37 2 255 3 BCG_2993 Aldo-keto reductase BCG_2993 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
A1T726 2.48e-49 167 37 2 255 3 Mvan_2161 Aldo-keto reductase Mvan_2161 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A5U6Y1 3.34e-49 166 37 2 255 3 MRA_2999 Aldo-keto reductase MRA_2999 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P9WQA5 3.34e-49 166 37 2 255 1 Rv2971 Aldo-keto reductase Rv2971 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQA4 3.34e-49 166 37 2 255 3 MT3049 Aldo-keto reductase MT3049 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q6IMN8 5.51e-49 166 31 3 276 1 alrA Aldose reductase A Dictyostelium discoideum
A0PQ11 1.87e-48 164 38 2 255 3 MUL_1987 Aldo-keto reductase MUL_1987 Mycobacterium ulcerans (strain Agy99)
A0QV10 5.07e-47 160 35 2 255 1 MSMEG_2408 Aldo-keto reductase MSMEG_2408/MSMEI_2347 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P14065 2.79e-46 160 34 7 291 1 GCY1 Glycerol 2-dehydrogenase (NADP(+)) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A0QJ99 4.59e-46 158 37 2 255 3 MAV_3816 Aldo-keto reductase MAV_3816 Mycobacterium avium (strain 104)
P58744 1.68e-45 157 36 4 256 5 dkgA Putative 2,5-diketo-D-gluconic acid reductase A Salmonella typhi
Q8ZM06 1.79e-45 157 36 4 256 3 dkgA 2,5-diketo-D-gluconic acid reductase A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q73SC5 2.29e-45 157 39 3 251 3 MAP_4149 Aldo-keto reductase MAP_4149 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QL30 2.61e-45 157 39 3 252 3 MAV_4483 Aldo-keto reductase MAV_4483 Mycobacterium avium (strain 104)
A3PXS9 2.98e-45 156 35 2 255 3 Mjls_1918 Aldo-keto reductase Mjls_1918 Mycobacterium sp. (strain JLS)
Q73VK6 5.93e-45 155 36 2 255 3 MAP_3007 Aldo-keto reductase MAP_3007 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A1UEC5 6.96e-45 155 35 2 255 3 Mkms_1984 Aldo-keto reductase Mkms_1984 Mycobacterium sp. (strain KMS)
Q1BAN7 6.96e-45 155 35 2 255 3 Mmcs_1938 Aldo-keto reductase Mmcs_1938 Mycobacterium sp. (strain MCS)
O49133 1.34e-44 155 32 6 296 1 GALUR D-galacturonate reductase Fragaria ananassa
A0QV09 4.94e-44 153 36 2 255 1 MSMEG_2407 Aldo-keto reductase MSMEG_2407/MSMEI_2346 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q12458 1.52e-43 153 35 6 262 1 YPR1 Putative reductase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O32210 5.21e-43 150 34 3 257 1 yvgN Glyoxal reductase Bacillus subtilis (strain 168)
O69462 7.77e-43 150 35 3 258 3 ML1669 Aldo-keto reductase ML1669 Mycobacterium leprae (strain TN)
B8ZS00 7.77e-43 150 35 3 258 3 MLBr01669 Aldo-keto reductase MLBr01669 Mycobacterium leprae (strain Br4923)
Q6Y0Z3 8.48e-43 151 31 6 298 1 XYL1 NADH-dependent D-xylose reductase Candida parapsilosis
Q9GV41 9.89e-43 149 32 4 257 1 None 9,11-endoperoxide prostaglandin H2 reductase Trypanosoma brucei brucei
P27800 3.27e-42 149 32 7 296 1 ARI Aldehyde reductase 1 Sporidiobolus salmonicolor
P52898 3.71e-42 149 30 6 289 2 None Dihydrodiol dehydrogenase 3 Bos taurus
Q10494 8.56e-42 148 33 6 282 3 SPAC26F1.07 Uncharacterized oxidoreductase C26F1.07 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P74308 1.97e-41 147 35 4 288 1 slr0942 Aldo/keto reductase slr0942 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P28475 2.69e-41 147 31 5 292 2 S6PDH NADP-dependent D-sorbitol-6-phosphate dehydrogenase Malus domestica
P52897 4.91e-41 146 30 6 289 2 None Prostaglandin F synthase 2 Bos taurus
P87039 6.15e-41 146 33 6 298 1 xyrB NADPH-dependent D-xylose reductase II,III Candida tropicalis
P05980 7.6e-41 146 30 6 285 1 None Prostaglandin F synthase 1 Bos taurus
A3PXT0 1.14e-40 144 33 2 255 3 Mjls_1919 Aldo-keto reductase Mjls_1919 Mycobacterium sp. (strain JLS)
A1UEC6 1.19e-40 144 33 2 255 3 Mkms_1985 Aldo-keto reductase Mkms_1985 Mycobacterium sp. (strain KMS)
Q54NZ7 1.25e-40 145 31 6 290 3 alrB Aldose reductase B Dictyostelium discoideum
B4F9A4 1.35e-40 145 31 8 281 1 DMAS1 Deoxymugineic acid synthase 1 Zea mays
O34678 1.54e-40 144 34 5 265 1 ytbE Uncharacterized oxidoreductase YtbE Bacillus subtilis (strain 168)
P22045 2.53e-40 144 32 4 261 1 P100/11E 9,11-endoperoxide prostaglandin H2 reductase Leishmania major
O13283 5.65e-40 144 33 6 298 3 xyrA NAD(P)H-dependent D-xylose reductase I,II Candida tropicalis
A0A1X9QHJ0 7.56e-40 143 32 10 296 2 DMAS1-D Deoxymugineic acid synthase 1-D Triticum aestivum
H9JTG9 1.82e-39 142 30 8 282 1 akr2e Aldo-keto reductase AKR2E4 Bombyx mori
Q95JH6 2.22e-39 142 30 6 292 2 AKR1C1 Aldo-keto reductase family 1 member C1 Macaca fuscata fuscata
P78736 2.5e-39 142 33 6 298 1 XYL1 NAD(P)H-dependent D-xylose reductase Pachysolen tannophilus
A0A1D5XGW0 2.91e-39 142 32 10 296 2 DMAS1-B Deoxymugineic acid synthase 1-B Triticum aestivum
P51857 3.9e-39 142 30 6 293 1 AKR1D1 Aldo-keto reductase family 1 member D1 Homo sapiens
O42888 4.52e-39 141 32 8 283 3 SPBC8E4.04 Uncharacterized oxidoreductase C8E4.04 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P50578 4.52e-39 141 29 5 289 1 AKR1A1 Aldo-keto reductase family 1 member A1 Sus scrofa
W5DYE3 4.59e-39 141 32 10 296 1 DMAS1-A Deoxymugineic acid synthase 1-A Triticum aestivum
P15339 4.94e-39 140 33 4 249 1 dkgB 2,5-diketo-D-gluconic acid reductase B Corynebacterium sp. (strain SHS752001)
Q01213 8.14e-39 140 29 5 297 1 tdh 4-dihydromethyl-trisporate dehydrogenase Mucor mucedo
D3ZF77 8.35e-39 140 31 6 285 1 Akr1c15 Aldo-keto reductase family 1 member C15 Rattus norvegicus
Q3ZCJ2 1.16e-38 140 29 5 289 1 AKR1A1 Aldo-keto reductase family 1 member A1 Bos taurus
Q95JH7 1.42e-38 140 29 6 292 1 AKR1C1 Aldo-keto reductase family 1 member C1 Macaca fascicularis
P31867 1.85e-38 140 30 6 298 1 XYL1 NAD(P)H-dependent D-xylose reductase Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
O94735 2.12e-38 139 29 5 298 1 XYL1 NADPH-dependent D-xylose reductase Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324)
Q09632 3.86e-38 139 31 7 267 3 ZK1290.5 Uncharacterized oxidoreductase ZK1290.5 Caenorhabditis elegans
Q9P430 4.88e-38 139 30 6 300 3 XYL1 NAD(P)H-dependent D-xylose reductase Scheffersomyces shehatae
Q876L8 6.1e-38 138 31 6 299 1 xyl1 NAD(P)H-dependent D-xylose reductase xyl1 Hypocrea jecorina
P26690 6.5e-38 138 30 11 302 1 None NAD(P)H-dependent 6'-deoxychalcone synthase Glycine max
Q10PE7 7.65e-38 138 31 9 295 1 DMAS1 Deoxymugineic acid synthase 1 Oryza sativa subsp. japonica
Q84TF0 7.78e-38 138 32 6 260 1 AKR4C10 Aldo-keto reductase family 4 member C10 Arabidopsis thaliana
Q5REQ0 8.28e-38 138 29 6 292 2 AKR1C1 Aldo-keto reductase family 1 member C1 Pongo abelii
Q0PCF4 1.19e-37 137 31 10 296 1 DMAS1 Deoxymugineic acid synthase 1 Hordeum vulgare
Q9SQ64 1.21e-37 137 30 8 278 1 COR2 Non-functional NADPH-dependent codeinone reductase 2 Papaver somniferum
P82125 1.25e-37 137 30 5 283 1 AKR1E2 1,5-anhydro-D-fructose reductase Sus scrofa
P80508 1.56e-37 137 29 6 292 1 AKR1C5 Prostaglandin-E(2) 9-reductase Oryctolagus cuniculus
P52895 1.95e-37 137 29 6 292 1 AKR1C2 Aldo-keto reductase family 1 member C2 Homo sapiens
P51635 2.13e-37 137 28 5 289 1 Akr1a1 Aldo-keto reductase family 1 member A1 Rattus norvegicus
Q6AZW2 2.52e-37 137 29 7 289 2 akr1a1a Aldo-keto reductase family 1 member A1-A Danio rerio
O74237 3.64e-37 136 30 6 301 1 XYL1 NAD(P)H-dependent D-xylose reductase Candida tenuis
P49378 4.6e-37 136 29 7 303 3 XYL1 NAD(P)H-dependent D-xylose reductase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q04828 5.21e-37 136 29 6 292 1 AKR1C1 Aldo-keto reductase family 1 member C1 Homo sapiens
Q7G764 6.85e-37 135 30 10 283 1 Os10g0113000 Probable NAD(P)H-dependent oxidoreductase 1 Oryza sativa subsp. japonica
Q9JII6 2.15e-36 134 28 7 291 1 Akr1a1 Aldo-keto reductase family 1 member A1 Mus musculus
O60218 3.58e-36 134 30 8 280 1 AKR1B10 Aldo-keto reductase family 1 member B10 Homo sapiens
Q95JH5 4.21e-36 134 28 6 301 1 AKR1C4 Aldo-keto reductase family 1 member C4 Macaca fascicularis
P70694 4.39e-36 134 27 6 301 1 Akr1c6 Estradiol 17 beta-dehydrogenase 5 Mus musculus
Q5R5D5 4.73e-36 134 28 5 289 2 AKR1A1 Aldo-keto reductase family 1 member A1 Pongo abelii
P17516 4.99e-36 133 28 6 301 1 AKR1C4 Aldo-keto reductase family 1 member C4 Homo sapiens
O70473 5.43e-36 133 28 5 289 2 AKR1A1 Aldo-keto reductase family 1 member A1 Cricetulus griseus
Q1XAA8 5.9e-36 133 28 6 295 1 AKR1C23 Aldo-keto reductase family 1 member C23 Equus caballus
Q8X195 6.42e-36 133 29 7 303 1 XYL1 NADPH-dependent D-xylose reductase Candida boidinii
P14550 1.01e-35 132 28 5 289 1 AKR1A1 Aldo-keto reductase family 1 member A1 Homo sapiens
Q9M338 1.12e-35 132 32 7 281 1 AKR4C11 Aldo-keto reductase family 4 member C11 Arabidopsis thaliana
Q5BGA7 1.18e-35 132 31 6 297 3 xyl1 Probable NAD(P)H-dependent D-xylose reductase xyl1 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q95JH4 1.34e-35 132 28 6 301 1 AKR1C4 Aldo-keto reductase family 1 member C4 Macaca fuscata fuscata
Q2UKD0 1.6e-35 132 30 6 301 3 xyl1 Probable NAD(P)H-dependent D-xylose reductase xyl1 Aspergillus oryzae (strain ATCC 42149 / RIB 40)
B8N195 1.6e-35 132 30 6 301 3 xyl1 Probable NAD(P)H-dependent D-xylose reductase xyl1 Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
Q0PGJ6 1.72e-35 132 31 5 256 1 AKR4C9 NADPH-dependent aldo-keto reductase, chloroplastic Arabidopsis thaliana
P51652 2.09e-35 132 30 7 286 1 Akr1c18 Aldo-keto reductase family 1 member C18 Rattus norvegicus
Q9TV64 2.32e-35 132 29 6 293 2 AKR1D1 Aldo-keto reductase family 1 member D1 Oryctolagus cuniculus
Q0CUL0 2.4e-35 131 28 5 304 3 xyl1 Probable NAD(P)H-dependent D-xylose reductase xyl1 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q9P8R5 2.5e-35 131 30 7 301 2 xyl1 NAD(P)H-dependent D-xylose reductase xyl1 Aspergillus niger
A2Q8B5 2.5e-35 131 30 7 301 3 xyl1 Probable NAD(P)H-dependent D-xylose reductase xyl1 Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
Q9C1X5 2.5e-35 130 31 6 260 3 SPAP32A8.02 Uncharacterized oxidoreductase P32A8.02 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8VC28 3.69e-35 131 29 6 299 1 Akr1c13 Aldo-keto reductase family 1 member C13 Mus musculus
C9JRZ8 4.36e-35 130 30 8 280 1 AKR1B15 Aldo-keto reductase family 1 member B15 Homo sapiens
P16116 5.56e-35 130 33 6 273 1 AKR1B1 Aldo-keto reductase family 1 member B1 Bos taurus
Q0GYU4 6.12e-35 130 31 11 298 1 gld2 Glycerol 2-dehydrogenase (NADP(+)) Hypocrea jecorina
A1CRI1 6.17e-35 130 30 8 297 3 xyl1 Probable NAD(P)H-dependent D-xylose reductase xyl1 Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
Q6W8P9 7.88e-35 130 28 7 291 1 PGFS Aldo-keto reductase family 1 member C23-like protein Equus caballus
P80276 7.96e-35 130 31 6 300 1 AKR1B1 Aldo-keto reductase family 1 member B1 Sus scrofa
P15122 1.39e-34 129 32 7 297 2 AKR1B1 Aldo-keto reductase family 1 member B1 Oryctolagus cuniculus
Q9SQ69 1.5e-34 129 29 9 298 1 COR1.2 NADPH-dependent codeinone reductase 1-2 Papaver somniferum
Q91WR5 1.75e-34 129 29 7 291 1 Akr1c21 Aldo-keto reductase family 1 member C21 Mus musculus
P42330 1.93e-34 129 28 6 299 1 AKR1C3 Aldo-keto reductase family 1 member C3 Homo sapiens
Q5R7C9 2.75e-34 129 29 7 302 2 AKR1C3 Aldo-keto reductase family 1 member C3 Pongo abelii
Q8VCX1 3.15e-34 129 29 6 292 1 Akr1d1 Aldo-keto reductase family 1 member D1 Mus musculus
Q7G765 4.42e-34 128 27 8 279 2 Os10g0113100 Probable NAD(P)H-dependent oxidoreductase 2 Oryza sativa subsp. japonica
Q55FL3 6.73e-34 128 27 6 286 3 alrC Aldose reductase C Dictyostelium discoideum
O80944 7.33e-34 127 31 6 256 1 AKR4C8 Aldo-keto reductase family 4 member C8 Arabidopsis thaliana
Q4WJT9 1.09e-33 127 28 5 297 3 xyl1 Probable NAD(P)H-dependent D-xylose reductase xyl1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
B0XNR0 1.09e-33 127 28 5 297 3 xyl1 Probable NAD(P)H-dependent D-xylose reductase xyl1 Aspergillus fumigatus (strain CBS 144.89 / FGSC A1163 / CEA10)
A1D4E3 1.15e-33 127 28 6 302 3 xyl1 Probable NAD(P)H-dependent D-xylose reductase xyl1 Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
Q9SQ67 1.36e-33 127 29 10 299 1 COR1.4 NADPH-dependent codeinone reductase 1-4 Papaver somniferum
C5FFQ7 1.54e-33 127 29 7 301 3 xyl1 Probable NAD(P)H-dependent D-xylose reductase xyl1 Arthroderma otae (strain ATCC MYA-4605 / CBS 113480)
Q568L5 1.59e-33 127 31 6 289 2 akr1a1b Aldo-keto reductase family 1 member A1-B Danio rerio
P15121 1.76e-33 126 33 7 276 1 AKR1B1 Aldo-keto reductase family 1 member B1 Homo sapiens
P31210 1.9e-33 127 29 7 293 1 Akr1d1 Aldo-keto reductase family 1 member D1 Rattus norvegicus
P45376 1.91e-33 126 32 7 297 1 Akr1b1 Aldo-keto reductase family 1 member B1 Mus musculus
Q3ZFI7 1.95e-33 126 31 7 268 1 gar1 D-galacturonate reductase Hypocrea jecorina
O14088 2.82e-33 125 29 4 256 3 SPAC2F3.05c Uncharacterized oxidoreductase C2F3.05c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q4R802 7.94e-33 125 26 6 305 2 AKR1E2 1,5-anhydro-D-fructose reductase Macaca fascicularis
G4N708 1.02e-32 125 27 5 302 2 XYR1 NAD(P)H-dependent D-xylose reductase XYR1 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
Q02198 1.1e-32 124 31 5 274 1 morA Morphine 6-dehydrogenase Pseudomonas putida
Q8K023 1.27e-32 124 28 8 301 1 Akr1c18 Aldo-keto reductase family 1 member C18 Mus musculus
Q9DCT1 1.36e-32 124 30 6 286 1 Akr1e2 1,5-anhydro-D-fructose reductase Mus musculus
P38715 2.95e-32 124 27 7 306 1 GRE3 NADPH-dependent aldose reductase GRE3 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P17264 6.1e-32 122 29 6 285 1 None Rho crystallin Aquarana catesbeiana
P07943 6.42e-32 122 31 7 297 1 Akr1b1 Aldo-keto reductase family 1 member B1 Rattus norvegicus
Q0GYU5 1.06e-31 122 32 12 306 1 gld1 D/L-glyceraldehyde reductase Hypocrea jecorina
Q6GMC7 1.15e-31 122 30 5 289 2 akr1a1 Aldo-keto reductase family 1 member A1 Xenopus laevis
G4MZI3 1.8e-31 121 29 6 310 1 PRD1 NAD(P)H-dependent pentose reductase Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
Q5U1Y4 1.87e-31 121 29 6 291 2 Akr1e2 1,5-anhydro-D-fructose reductase Rattus norvegicus
A0A2P1GIY9 2.01e-31 121 28 9 294 1 Redox2 Protein REDOX 2 Catharanthus roseus
Q96JD6 2.74e-31 121 27 6 302 1 AKR1E2 1,5-anhydro-D-fructose reductase Homo sapiens
Q76L36 8.16e-31 119 31 9 270 1 cpr-c2 NADPH-dependent conjugated polyketone reductase C2 Candida parapsilosis
Q5RJP0 8.97e-31 119 30 7 284 1 Akr1b7 Aldo-keto reductase family 1 member B7 Rattus norvegicus
P21300 1.16e-30 119 32 7 281 1 Akr1b7 Aldo-keto reductase family 1 member B7 Mus musculus
P0DKI7 1.38e-30 123 29 11 296 1 STORR Bifunctional protein STORR Papaver somniferum
Q28FD1 3.14e-30 118 30 5 289 2 akr1a1 Aldo-keto reductase family 1 member A1 Xenopus tropicalis
P02532 3.51e-30 118 28 6 285 2 None Rho crystallin Rana temporaria
P45377 6.19e-30 117 29 5 281 1 Akr1b8 Aldose reductase-related protein 2 Mus musculus
P23457 8.02e-30 117 28 7 285 1 Akr1c9 3-alpha-hydroxysteroid dehydrogenase Rattus norvegicus
Q76L37 1.53e-29 116 31 6 267 1 cpr-c1 NADPH-dependent conjugated polyketone reductase C1 Candida parapsilosis
O13848 2.94e-29 115 30 8 266 1 SPAC19G12.09 NAD/NADP-dependent indole-3-acetaldehyde reductase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q6AYQ2 3e-29 115 29 8 292 2 Akr1c21 Aldo-keto reductase family 1 member C21 Rattus norvegicus
O08782 4.41e-28 112 30 7 280 1 AKR1B8 Aldose reductase-related protein 2 Cricetulus griseus
P47137 1.1e-27 110 23 5 264 1 YJR096W Uncharacterized oxidoreductase YJR096W Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B9VRJ2 1.13e-27 111 29 8 282 1 COR1.5 NADPH-dependent codeinone reductase 1-5 Papaver somniferum
E7C196 1.23e-27 111 28 8 287 1 None Methylecgonone reductase Erythroxylum coca
Q5ZK84 1.71e-27 111 28 5 289 2 AKR1A1 Aldo-keto reductase family 1 member A1 Gallus gallus
Q9SQ68 1.97e-27 110 29 10 299 1 COR1.3 NADPH-dependent codeinone reductase 1-3 Papaver somniferum
Q9SQ70 3.87e-26 107 29 9 283 1 COR1.1 NADPH-dependent codeinone reductase 1-1 Papaver somniferum
P82809 1.02e-25 106 26 6 300 1 AKR1C13 Aldo-keto reductase family 1 member C13 Mesocricetus auratus
P38115 1.48e-25 106 29 6 269 1 ARA1 D-arabinose dehydrogenase [NAD(P)+] heavy chain Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P76234 2.09e-24 102 28 9 267 4 yeaE Uncharacterized protein YeaE Escherichia coli (strain K12)
Q9USV2 4.87e-23 98 29 4 251 3 SPBC28F2.05c Uncharacterized oxidoreductase C28F2.05 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q07551 5.46e-21 93 27 8 267 1 YDL124W NADPH-dependent alpha-keto amide reductase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q5T2L2 1.8e-16 77 35 2 104 5 AKR1C8 Putative aldo-keto reductase family 1 member C8 Homo sapiens
Q3L181 3.04e-16 80 25 10 303 1 PR Perakine reductase Rauvolfia serpentina
P46336 3.66e-15 77 27 9 276 1 iolS Aldo-keto reductase IolS Bacillus subtilis (strain 168)
P42972 3.87e-15 77 27 11 271 3 ycsN Uncharacterized oxidoreductase YcsN Bacillus subtilis (strain 168)
P76187 1.28e-14 75 26 11 276 1 ydhF Oxidoreductase YdhF Escherichia coli (strain K12)
C6TBN2 1.59e-14 75 26 9 281 2 AKR1 Probable aldo-keto reductase 1 Glycine max
P80874 1.72e-14 75 31 9 201 1 yhdN Aldo-keto reductase YhdN Bacillus subtilis (strain 168)
P46905 4.47e-14 73 27 10 275 3 yccK Uncharacterized oxidoreductase YccK Bacillus subtilis (strain 168)
A0A3B1EFQ1 1.17e-12 70 26 11 280 1 str7 Aldo-keto reductase str7 Strobilurus tenacellus
A9CEY6 5e-11 65 24 11 273 1 smoB 6-dehydroglucose reductase Agrobacterium fabrum (strain C58 / ATCC 33970)
O59826 1.71e-10 63 27 13 286 3 SPCC965.06 Putative voltage-gated potassium channel subunit beta Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P63485 1.19e-09 61 24 12 290 3 BQ2027_MB2320 Uncharacterized oxidoreductase Mb2320 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQA7 1.19e-09 61 24 12 290 1 Rv2298 Uncharacterized oxidoreductase Rv2298 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQA6 1.19e-09 61 24 12 290 3 MT2355 Uncharacterized oxidoreductase MT2355 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q13303 1.93e-09 60 25 11 297 1 KCNAB2 Voltage-gated potassium channel subunit beta-2 Homo sapiens
P62483 2.37e-09 60 25 11 297 1 Kcnab2 Voltage-gated potassium channel subunit beta-2 Rattus norvegicus
P62482 2.37e-09 60 25 11 297 1 Kcnab2 Voltage-gated potassium channel subunit beta-2 Mus musculus
Q9PTM5 2.69e-09 60 24 10 295 2 kcnab2 Voltage-gated potassium channel subunit beta-2 Xenopus laevis
F4HPY8 6.24e-09 59 25 11 292 3 At1g60750 Probable aldo-keto reductase 6 Arabidopsis thaliana
Q27955 9.95e-09 58 24 10 295 1 KCNAB2 Voltage-gated potassium channel subunit beta-2 Bos taurus
Q28528 1.44e-08 58 24 10 295 2 KCNAB1 Voltage-gated potassium channel subunit beta-1 Mustela putorius
Q14722 1.72e-08 58 24 10 295 1 KCNAB1 Voltage-gated potassium channel subunit beta-1 Homo sapiens
Q9XT31 2.03e-08 58 24 10 295 1 KCNAB1 Voltage-gated potassium channel subunit beta-1 Oryctolagus cuniculus
P63144 2.48e-08 57 24 10 295 1 Kcnab1 Voltage-gated potassium channel subunit beta-1 Rattus norvegicus
Q4PJK1 2.48e-08 57 24 10 295 2 KCNAB1 Voltage-gated potassium channel subunit beta-1 Bos taurus
P63143 2.54e-08 57 24 10 295 1 Kcnab1 Voltage-gated potassium channel subunit beta-1 Mus musculus
Q7XT99 2.62e-08 57 25 10 265 2 Os04g0338000 Probable aldo-keto reductase 2 Oryza sativa subsp. japonica
Q93ZN2 3.07e-08 57 24 10 297 2 At1g60710 Probable aldo-keto reductase 4 Arabidopsis thaliana
P25906 4.33e-08 56 25 9 271 1 pdxI Pyridoxine 4-dehydrogenase Escherichia coli (strain K12)
Q9PWR1 5.36e-08 56 24 11 295 2 KCNAB1 Voltage-gated potassium channel subunit beta-1 Gallus gallus
A2XRZ0 8e-08 55 24 9 265 3 OsI_15387 Probable aldo-keto reductase 2 Oryza sativa subsp. indica
O23016 8.43e-08 55 23 8 260 1 KAB1 Probable voltage-gated potassium channel subunit beta Arabidopsis thaliana
P0A9T5 1.2e-07 55 26 14 323 3 tas Protein tas Shigella flexneri
P0A9T4 1.2e-07 55 26 14 323 1 tas Protein tas Escherichia coli (strain K12)
O22707 1.26e-07 55 24 11 297 3 At1g60690 Probable aldo-keto reductase 3 Arabidopsis thaliana
Q9PTM4 2.96e-07 54 27 5 153 2 kcnab3 Voltage-gated potassium channel subunit beta-3 Xenopus laevis
O43448 5.05e-07 53 28 4 146 1 KCNAB3 Voltage-gated potassium channel subunit beta-3 Homo sapiens
Q94A68 6.4e-07 53 22 11 285 1 At1g06690 Uncharacterized oxidoreductase At1g06690, chloroplastic Arabidopsis thaliana
Q9C5B9 1.09e-06 52 24 12 291 2 At1g10810 Probable aldo-keto reductase 1 Arabidopsis thaliana
P54569 1.79e-06 51 25 7 189 3 yqkF Uncharacterized oxidoreductase YqkF Bacillus subtilis (strain 168)
Q84M96 2.44e-06 51 26 14 285 2 AGD2 Probable aldo-keto reductase 2 Arabidopsis thaliana
Q63494 3.17e-06 51 27 4 147 2 Kcnab3 Voltage-gated potassium channel subunit beta-3 Rattus norvegicus
K3VD70 3.6e-06 50 23 12 291 2 FPSE_08125 Aldo-keto reductase FPSE_08125 Fusarium pseudograminearum (strain CS3096)
Q40648 6.55e-06 50 20 8 267 1 KOB1 Probable voltage-gated potassium channel subunit beta Oryza sativa subsp. japonica
Q2G5J3 1.47e-05 48 27 6 179 1 squF 6-dehydroglucose reductase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
P40691 1.96e-05 48 24 10 266 2 None Auxin-induced protein PCNT115 Nicotiana tabacum
P77735 2.6e-05 48 22 8 293 1 yajO 1-deoxyxylulose-5-phosphate synthase YajO Escherichia coli (strain K12)
Q04212 3.36e-05 48 30 4 123 1 ARA2 D-arabinose 1-dehydrogenase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8NHP1 4.34e-05 47 31 5 135 1 AKR7L Aflatoxin B1 aldehyde reductase member 4 Homo sapiens
Q56Y42 6.27e-05 47 22 12 300 1 PLR1 Pyridoxal reductase, chloroplastic Arabidopsis thaliana
Q9ASZ9 8.38e-05 47 23 11 302 2 At1g60730 Probable aldo-keto reductase 5 Arabidopsis thaliana
M2YMU7 0.000116 46 21 10 305 2 MYCFIDRAFT_87468 Aldo-keto reductase MYCFIDRAFT_87468 Pseudocercospora fijiensis (strain CIRAD86)
P77256 0.000509 44 21 10 301 1 ydjG NADH-specific methylglyoxal reductase Escherichia coli (strain K12)
Q00727 0.000512 44 32 5 122 2 stcV Norsolorinic acid reductase stcV Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
O05408 0.000853 43 24 8 282 3 yrpG Uncharacterized oxidoreductase YrpG Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS03940
Feature type CDS
Gene dkgB
Product 2,5-didehydrogluconate reductase DkgB
Location 887460 - 888263 (strand: -1)
Length 804 (nucleotides) / 267 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3850
Orthogroup size 2
N. genomes 2

Actions

Genomic region

Domains

PF00248 Aldo/keto reductase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0656 Secondary metabolites biosynthesis, transport and catabolism (Q) Q Aldo/keto reductase, related to diketogulonate reductase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06222 2,5-diketo-D-gluconate reductase B [EC:1.1.1.346] - -

Protein Sequence

MSVPVLGLGTFRLKDDAVINSVKTALELGYRAIDTAQIYENESAIGQAIAESGISRDALYITTKIWVENLSKDKLIPSLKQSLSDLQTDYVDLTLVHWPSPNDAVSVKEFMQELLAAKQMGLTREIGISNFTIPLMEQAIAAVGVENIATNQIELSPYLQNHKVVNWAKQHGIHITSYMTLAYGKALKDETIQTIAKKHNATPAQIILAWAMNEGYSVIPSSTKRENLASNLLSVNIKLDSEDKQAIAKLDCHDRLVSPEGLAPHWD

Flanking regions ( +/- flanking 50bp)

ACAAATATCAACTTAATTCCCCTACTGTTATTACCTTTCAGGAGAGATGTATGAGTGTTCCCGTTTTAGGTCTTGGTACTTTTCGTTTAAAAGACGATGCGGTTATAAATTCTGTAAAAACTGCACTAGAACTAGGTTATCGTGCTATTGATACAGCACAAATTTATGAAAATGAATCTGCTATAGGACAAGCTATTGCAGAAAGTGGTATATCTCGCGACGCGCTTTACATCACAACAAAAATCTGGGTAGAAAATTTAAGTAAAGATAAATTAATTCCTAGTTTGAAACAAAGCTTAAGTGATTTACAAACAGATTATGTTGACTTAACTCTAGTACACTGGCCATCACCAAATGATGCAGTTTCTGTTAAAGAATTTATGCAAGAGTTATTAGCTGCGAAACAGATGGGATTAACGCGAGAAATTGGTATTTCAAATTTTACCATTCCATTAATGGAACAAGCTATTGCTGCCGTTGGTGTTGAAAATATCGCAACAAACCAAATCGAATTATCACCTTATTTACAAAATCATAAAGTGGTAAATTGGGCTAAACAGCATGGCATTCATATTACATCTTATATGACTCTAGCTTACGGCAAAGCATTAAAAGATGAAACAATACAAACCATTGCTAAAAAACACAATGCAACACCAGCACAAATCATTTTAGCTTGGGCTATGAATGAAGGTTATTCTGTTATTCCATCTTCAACAAAACGTGAAAATTTAGCCAGTAATTTACTCAGCGTAAATATCAAATTGGATAGTGAAGATAAACAAGCGATTGCAAAGTTAGATTGTCATGATCGTTTAGTTAGCCCAGAAGGTTTAGCGCCTCATTGGGATTAAGATTAACCAATTTAAATCGTAATATAGGTGATATTATTTTTATCACCTAT