Homologs in group_3980

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_3980

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3980

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A8AI79 1.58e-37 124 62 0 98 3 cbpM Chaperone modulatory protein CbpM Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q7CQS3 9.85e-37 122 60 0 99 3 cbpM Chaperone modulatory protein CbpM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGQ8 9.85e-37 122 60 0 99 3 cbpM Chaperone modulatory protein CbpM Salmonella typhi
B4TSM2 9.85e-37 122 60 0 99 3 cbpM Chaperone modulatory protein CbpM Salmonella schwarzengrund (strain CVM19633)
C0Q894 9.85e-37 122 60 0 99 3 cbpM Chaperone modulatory protein CbpM Salmonella paratyphi C (strain RKS4594)
A9N6S3 9.85e-37 122 60 0 99 3 cbpM Chaperone modulatory protein CbpM Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T2U4 9.85e-37 122 60 0 99 3 cbpM Chaperone modulatory protein CbpM Salmonella newport (strain SL254)
B4TEN4 9.85e-37 122 60 0 99 3 cbpM Chaperone modulatory protein CbpM Salmonella heidelberg (strain SL476)
B5R6G2 9.85e-37 122 60 0 99 3 cbpM Chaperone modulatory protein CbpM Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R048 9.85e-37 122 60 0 99 3 cbpM Chaperone modulatory protein CbpM Salmonella enteritidis PT4 (strain P125109)
B5FR39 9.85e-37 122 60 0 99 3 cbpM Chaperone modulatory protein CbpM Salmonella dublin (strain CT_02021853)
Q57QP3 9.85e-37 122 60 0 99 3 cbpM Chaperone modulatory protein CbpM Salmonella choleraesuis (strain SC-B67)
B5F1Z4 9.85e-37 122 60 0 99 3 cbpM Chaperone modulatory protein CbpM Salmonella agona (strain SL483)
B5BBH3 1.16e-36 122 60 0 99 3 cbpM Chaperone modulatory protein CbpM Salmonella paratyphi A (strain AKU_12601)
Q5PGA1 1.16e-36 122 60 0 99 3 cbpM Chaperone modulatory protein CbpM Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A9MH54 1.78e-36 122 60 0 99 3 cbpM Chaperone modulatory protein CbpM Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q1RDL7 1.8e-36 122 59 0 98 3 cbpM Chaperone modulatory protein CbpM Escherichia coli (strain UTI89 / UPEC)
Q8FJ51 1.8e-36 122 59 0 98 3 cbpM Chaperone modulatory protein CbpM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJ67 1.8e-36 122 59 0 98 3 cbpM Chaperone modulatory protein CbpM Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A9Q6 1.8e-36 122 59 0 98 3 cbpM Chaperone modulatory protein CbpM Escherichia coli O1:K1 / APEC
B7MPT1 1.8e-36 122 59 0 98 3 cbpM Chaperone modulatory protein CbpM Escherichia coli O81 (strain ED1a)
B7MIE5 1.8e-36 122 59 0 98 3 cbpM Chaperone modulatory protein CbpM Escherichia coli O45:K1 (strain S88 / ExPEC)
Q3Z3C4 3.96e-36 121 59 0 98 3 cbpM Chaperone modulatory protein CbpM Shigella sonnei (strain Ss046)
P63266 3.96e-36 121 59 0 98 3 cbpM Chaperone modulatory protein CbpM Shigella flexneri
Q0T635 3.96e-36 121 59 0 98 3 cbpM Chaperone modulatory protein CbpM Shigella flexneri serotype 5b (strain 8401)
Q31YR0 3.96e-36 121 59 0 98 3 cbpM Chaperone modulatory protein CbpM Shigella boydii serotype 4 (strain Sb227)
B2TTP9 3.96e-36 121 59 0 98 3 cbpM Chaperone modulatory protein CbpM Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LJ05 3.96e-36 121 59 0 98 3 cbpM Chaperone modulatory protein CbpM Escherichia coli (strain SMS-3-5 / SECEC)
B6I975 3.96e-36 121 59 0 98 3 cbpM Chaperone modulatory protein CbpM Escherichia coli (strain SE11)
B7N3F4 3.96e-36 121 59 0 98 3 cbpM Chaperone modulatory protein CbpM Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P63264 3.96e-36 121 59 0 98 1 cbpM Chaperone modulatory protein CbpM Escherichia coli (strain K12)
B1IV98 3.96e-36 121 59 0 98 3 cbpM Chaperone modulatory protein CbpM Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZYV1 3.96e-36 121 59 0 98 3 cbpM Chaperone modulatory protein CbpM Escherichia coli O9:H4 (strain HS)
B1X8V4 3.96e-36 121 59 0 98 3 cbpM Chaperone modulatory protein CbpM Escherichia coli (strain K12 / DH10B)
C4ZQC7 3.96e-36 121 59 0 98 3 cbpM Chaperone modulatory protein CbpM Escherichia coli (strain K12 / MC4100 / BW2952)
B7M8Y2 3.96e-36 121 59 0 98 3 cbpM Chaperone modulatory protein CbpM Escherichia coli O8 (strain IAI1)
B7NLC6 3.96e-36 121 59 0 98 3 cbpM Chaperone modulatory protein CbpM Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YU42 3.96e-36 121 59 0 98 3 cbpM Chaperone modulatory protein CbpM Escherichia coli O157:H7 (strain EC4115 / EHEC)
P63265 3.96e-36 121 59 0 98 3 cbpM Chaperone modulatory protein CbpM Escherichia coli O157:H7
B7LFA8 3.96e-36 121 59 0 98 3 cbpM Chaperone modulatory protein CbpM Escherichia coli (strain 55989 / EAEC)
A7ZKA4 3.96e-36 121 59 0 98 3 cbpM Chaperone modulatory protein CbpM Escherichia coli O139:H28 (strain E24377A / ETEC)
Q88DH8 5.87e-23 87 46 0 90 3 cbpM Chaperone modulatory protein CbpM Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W9N5 8.52e-23 87 46 0 90 3 cbpM Chaperone modulatory protein CbpM Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1I491 1.04e-22 87 47 0 88 3 cbpM Chaperone modulatory protein CbpM Pseudomonas entomophila (strain L48)
B1J5W6 8.43e-22 85 44 0 88 3 cbpM Chaperone modulatory protein CbpM Pseudomonas putida (strain W619)
B0KK25 1.33e-21 84 45 0 88 3 cbpM Chaperone modulatory protein CbpM Pseudomonas putida (strain GB-1)
Q83CJ1 8.63e-06 43 34 2 97 3 cbpM Chaperone modulatory protein CbpM Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NDK7 8.63e-06 43 34 2 97 3 cbpM Chaperone modulatory protein CbpM Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KE66 8.63e-06 43 34 2 97 3 cbpM Chaperone modulatory protein CbpM Coxiella burnetii (strain Dugway 5J108-111)
B6IZY6 8.63e-06 43 34 2 97 3 cbpM Chaperone modulatory protein CbpM Coxiella burnetii (strain CbuG_Q212)
B6J7F6 8.63e-06 43 34 2 97 3 cbpM Chaperone modulatory protein CbpM Coxiella burnetii (strain CbuK_Q154)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS03930
Feature type CDS
Gene cbpM
Product chaperone modulator CbpM
Location 886058 - 886363 (strand: 1)
Length 306 (nucleotides) / 101 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3980
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF13591 MerR HTH family regulatory protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K18997 chaperone modulatory protein CbpM - -

Protein Sequence

MAQLTTIFTMTELCHHTGVSKEELQEIVELGVIEPVEITTQEWFFNDDAVVVVHRALKLHRELALDWHGIAIALTLLDENERLKQDNKQLRQQLMRFINNE

Flanking regions ( +/- flanking 50bp)

GCCGAAGCCCAAGCCGATTATAATCCACGTAAAAACTGGGAGAATAAATAATGGCACAATTAACAACAATATTTACTATGACTGAGCTTTGTCATCATACTGGTGTTTCCAAAGAGGAACTTCAAGAAATTGTTGAATTAGGGGTTATTGAGCCTGTAGAAATCACCACCCAGGAGTGGTTTTTCAATGATGATGCAGTTGTTGTTGTACATCGGGCGTTAAAACTTCATCGAGAGTTAGCATTGGATTGGCATGGTATTGCAATCGCCTTGACATTGTTGGATGAAAATGAACGATTAAAGCAAGATAATAAACAACTTCGACAACAGCTTATGCGCTTTATTAATAATGAATAAAGTGTCAGATAATATATCGCTAATTGCTTGAGAAAAACTAACTATAAAAA