Homologs in group_4374
0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product |
|---|
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| A8AI79 | 1.58e-37 | 124 | 62 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) |
| Q7CQS3 | 9.85e-37 | 122 | 60 | 0 | 99 | 3 | cbpM | Chaperone modulatory protein CbpM | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
| Q8XGQ8 | 9.85e-37 | 122 | 60 | 0 | 99 | 3 | cbpM | Chaperone modulatory protein CbpM | Salmonella typhi |
| B4TSM2 | 9.85e-37 | 122 | 60 | 0 | 99 | 3 | cbpM | Chaperone modulatory protein CbpM | Salmonella schwarzengrund (strain CVM19633) |
| C0Q894 | 9.85e-37 | 122 | 60 | 0 | 99 | 3 | cbpM | Chaperone modulatory protein CbpM | Salmonella paratyphi C (strain RKS4594) |
| A9N6S3 | 9.85e-37 | 122 | 60 | 0 | 99 | 3 | cbpM | Chaperone modulatory protein CbpM | Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) |
| B4T2U4 | 9.85e-37 | 122 | 60 | 0 | 99 | 3 | cbpM | Chaperone modulatory protein CbpM | Salmonella newport (strain SL254) |
| B4TEN4 | 9.85e-37 | 122 | 60 | 0 | 99 | 3 | cbpM | Chaperone modulatory protein CbpM | Salmonella heidelberg (strain SL476) |
| B5R6G2 | 9.85e-37 | 122 | 60 | 0 | 99 | 3 | cbpM | Chaperone modulatory protein CbpM | Salmonella gallinarum (strain 287/91 / NCTC 13346) |
| B5R048 | 9.85e-37 | 122 | 60 | 0 | 99 | 3 | cbpM | Chaperone modulatory protein CbpM | Salmonella enteritidis PT4 (strain P125109) |
| B5FR39 | 9.85e-37 | 122 | 60 | 0 | 99 | 3 | cbpM | Chaperone modulatory protein CbpM | Salmonella dublin (strain CT_02021853) |
| Q57QP3 | 9.85e-37 | 122 | 60 | 0 | 99 | 3 | cbpM | Chaperone modulatory protein CbpM | Salmonella choleraesuis (strain SC-B67) |
| B5F1Z4 | 9.85e-37 | 122 | 60 | 0 | 99 | 3 | cbpM | Chaperone modulatory protein CbpM | Salmonella agona (strain SL483) |
| B5BBH3 | 1.16e-36 | 122 | 60 | 0 | 99 | 3 | cbpM | Chaperone modulatory protein CbpM | Salmonella paratyphi A (strain AKU_12601) |
| Q5PGA1 | 1.16e-36 | 122 | 60 | 0 | 99 | 3 | cbpM | Chaperone modulatory protein CbpM | Salmonella paratyphi A (strain ATCC 9150 / SARB42) |
| A9MH54 | 1.78e-36 | 122 | 60 | 0 | 99 | 3 | cbpM | Chaperone modulatory protein CbpM | Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) |
| Q1RDL7 | 1.8e-36 | 122 | 59 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Escherichia coli (strain UTI89 / UPEC) |
| Q8FJ51 | 1.8e-36 | 122 | 59 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
| Q0TJ67 | 1.8e-36 | 122 | 59 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Escherichia coli O6:K15:H31 (strain 536 / UPEC) |
| A1A9Q6 | 1.8e-36 | 122 | 59 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Escherichia coli O1:K1 / APEC |
| B7MPT1 | 1.8e-36 | 122 | 59 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Escherichia coli O81 (strain ED1a) |
| B7MIE5 | 1.8e-36 | 122 | 59 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Escherichia coli O45:K1 (strain S88 / ExPEC) |
| Q3Z3C4 | 3.96e-36 | 121 | 59 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Shigella sonnei (strain Ss046) |
| P63266 | 3.96e-36 | 121 | 59 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Shigella flexneri |
| Q0T635 | 3.96e-36 | 121 | 59 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Shigella flexneri serotype 5b (strain 8401) |
| Q31YR0 | 3.96e-36 | 121 | 59 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Shigella boydii serotype 4 (strain Sb227) |
| B2TTP9 | 3.96e-36 | 121 | 59 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) |
| B1LJ05 | 3.96e-36 | 121 | 59 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Escherichia coli (strain SMS-3-5 / SECEC) |
| B6I975 | 3.96e-36 | 121 | 59 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Escherichia coli (strain SE11) |
| B7N3F4 | 3.96e-36 | 121 | 59 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) |
| P63264 | 3.96e-36 | 121 | 59 | 0 | 98 | 1 | cbpM | Chaperone modulatory protein CbpM | Escherichia coli (strain K12) |
| B1IV98 | 3.96e-36 | 121 | 59 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks) |
| A7ZYV1 | 3.96e-36 | 121 | 59 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Escherichia coli O9:H4 (strain HS) |
| B1X8V4 | 3.96e-36 | 121 | 59 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Escherichia coli (strain K12 / DH10B) |
| C4ZQC7 | 3.96e-36 | 121 | 59 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Escherichia coli (strain K12 / MC4100 / BW2952) |
| B7M8Y2 | 3.96e-36 | 121 | 59 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Escherichia coli O8 (strain IAI1) |
| B7NLC6 | 3.96e-36 | 121 | 59 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Escherichia coli O7:K1 (strain IAI39 / ExPEC) |
| B5YU42 | 3.96e-36 | 121 | 59 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Escherichia coli O157:H7 (strain EC4115 / EHEC) |
| P63265 | 3.96e-36 | 121 | 59 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Escherichia coli O157:H7 |
| B7LFA8 | 3.96e-36 | 121 | 59 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Escherichia coli (strain 55989 / EAEC) |
| A7ZKA4 | 3.96e-36 | 121 | 59 | 0 | 98 | 3 | cbpM | Chaperone modulatory protein CbpM | Escherichia coli O139:H28 (strain E24377A / ETEC) |
| Q88DH8 | 5.87e-23 | 87 | 46 | 0 | 90 | 3 | cbpM | Chaperone modulatory protein CbpM | Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) |
| A5W9N5 | 8.52e-23 | 87 | 46 | 0 | 90 | 3 | cbpM | Chaperone modulatory protein CbpM | Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1) |
| Q1I491 | 1.04e-22 | 87 | 47 | 0 | 88 | 3 | cbpM | Chaperone modulatory protein CbpM | Pseudomonas entomophila (strain L48) |
| B1J5W6 | 8.43e-22 | 85 | 44 | 0 | 88 | 3 | cbpM | Chaperone modulatory protein CbpM | Pseudomonas putida (strain W619) |
| B0KK25 | 1.33e-21 | 84 | 45 | 0 | 88 | 3 | cbpM | Chaperone modulatory protein CbpM | Pseudomonas putida (strain GB-1) |
| Q83CJ1 | 8.63e-06 | 43 | 34 | 2 | 97 | 3 | cbpM | Chaperone modulatory protein CbpM | Coxiella burnetii (strain RSA 493 / Nine Mile phase I) |
| A9NDK7 | 8.63e-06 | 43 | 34 | 2 | 97 | 3 | cbpM | Chaperone modulatory protein CbpM | Coxiella burnetii (strain RSA 331 / Henzerling II) |
| A9KE66 | 8.63e-06 | 43 | 34 | 2 | 97 | 3 | cbpM | Chaperone modulatory protein CbpM | Coxiella burnetii (strain Dugway 5J108-111) |
| B6IZY6 | 8.63e-06 | 43 | 34 | 2 | 97 | 3 | cbpM | Chaperone modulatory protein CbpM | Coxiella burnetii (strain CbuG_Q212) |
| B6J7F6 | 8.63e-06 | 43 | 34 | 2 | 97 | 3 | cbpM | Chaperone modulatory protein CbpM | Coxiella burnetii (strain CbuK_Q154) |
| Source | Proteus mirabilis HI4320 |
|---|---|
| Locus tag | PMI_RS03930 |
| Feature type | CDS |
| Gene | cbpM |
| Product | chaperone modulator CbpM |
| Location | 886058 - 886363 (strand: 1) |
| Length | 306 (nucleotides) / 101 (amino acids) |
| Accession | NC_010554 |
|---|---|
| Length | 4063606 nucleotides |
| Topology | circular |
| Plasmid | False |
| Orthogroup | group_4374 | |
|---|---|---|
| Orthogroup size | 1 | |
| N. genomes | 1 |
MAQLTTIFTMTELCHHTGVSKEELQEIVELGVIEPVEITTQEWFFNDDAVVVVHRALKLHRELALDWHGIAIALTLLDENERLKQDNKQLRQQLMRFINNE
GCCGAAGCCCAAGCCGATTATAATCCACGTAAAAACTGGGAGAATAAATAATGGCACAATTAACAACAATATTTACTATGACTGAGCTTTGTCATCATACTGGTGTTTCCAAAGAGGAACTTCAAGAAATTGTTGAATTAGGGGTTATTGAGCCTGTAGAAATCACCACCCAGGAGTGGTTTTTCAATGATGATGCAGTTGTTGTTGTACATCGGGCGTTAAAACTTCATCGAGAGTTAGCATTGGATTGGCATGGTATTGCAATCGCCTTGACATTGTTGGATGAAAATGAACGATTAAAGCAAGATAATAAACAACTTCGACAACAGCTTATGCGCTTTATTAATAATGAATAAAGTGTCAGATAATATATCGCTAATTGCTTGAGAAAAACTAACTATAAAAA
