Homologs in group_3884
1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product | |
|---|---|---|---|---|---|
| PMI_RS18655 | PMI_RS18655 | 30.2 | Proteus mirabilis HI4320 | - | type II toxin-antitoxin system RelE/ParE family toxin |
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| P9WHG7 | 3.14e-10 | 55 | 30 | 1 | 91 | 1 | parE1 | Toxin ParE1 | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| P9WHG6 | 3.14e-10 | 55 | 30 | 1 | 91 | 3 | parE1 | Toxin ParE1 | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Q9A459 | 5.86e-09 | 52 | 34 | 0 | 88 | 1 | parE4 | Toxin ParE4 | Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15) |
| Q9A9T8 | 1.7e-08 | 50 | 31 | 1 | 89 | 1 | parE1 | Toxin ParE1 | Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15) |
| Q79EC5 | 9.23e-05 | 41 | 24 | 1 | 90 | 1 | parE | Toxin ParE | Escherichia coli |
| Source | Proteus mirabilis HI4320 |
|---|---|
| Locus tag | PMI_RS02715 |
| Feature type | CDS |
| Gene | - |
| Product | type II toxin-antitoxin system RelE/ParE family toxin |
| Location | 592163 - 592456 (strand: 1) |
| Length | 294 (nucleotides) / 97 (amino acids) |
| Accession | NC_010554 |
|---|---|
| Length | 4063606 nucleotides |
| Topology | circular |
| Plasmid | False |
| Orthogroup | group_3884 | |
|---|---|---|
| Orthogroup size | 2 | |
| N. genomes | 1 |
| PF05016 | ParE toxin of type II toxin-antitoxin system, parDE |
|---|
| ID | Function(s) descr. | Function(s) cat. | Description |
|---|---|---|---|
| COG3668 | Mobilome: prophages, transposons (X) | X | Plasmid stabilization system protein ParE |
| KO | Description | Pathways | Modules |
|---|---|---|---|
| K19092 | toxin ParE1/3/4 | - | - |
MYKLSKLAEEDIYQIARYTIQQFGVTQAKKYHNDLKQTFELLAKAPWIGRECNWVCNGMRRFEFKKHSIYYLPKNDTLFITRLIHHSIDVDFVDFPK
AAGTAAAAATGACATGGATGATATTTTTGCAAGAGCTGAAAAGGACTTAAATGTATAAACTTTCTAAATTAGCAGAAGAAGATATTTACCAAATTGCTCGTTATACTATTCAACAATTTGGAGTAACTCAGGCAAAAAAATATCATAATGATTTAAAACAGACATTTGAGCTACTAGCTAAAGCACCTTGGATTGGACGAGAATGTAATTGGGTGTGTAATGGTATGAGACGATTTGAGTTTAAAAAACATTCAATTTATTATCTACCAAAAAATGATACCTTATTTATTACTCGTCTTATTCATCATTCAATAGATGTTGATTTTGTTGATTTTCCTAAATAAATATTTCATTACTTATTACCAAATATATTGTCCAGTCATATATCCTTTAG
