Homologs in group_4847

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4847

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4847

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P9WHG7 3.14e-10 55 30 1 91 1 parE1 Toxin ParE1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHG6 3.14e-10 55 30 1 91 3 parE1 Toxin ParE1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9A459 5.86e-09 52 34 0 88 1 parE4 Toxin ParE4 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9A9T8 1.7e-08 50 31 1 89 1 parE1 Toxin ParE1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q79EC5 9.23e-05 41 24 1 90 1 parE Toxin ParE Escherichia coli

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS02715
Feature type CDS
Gene -
Product type II toxin-antitoxin system RelE/ParE family toxin
Location 592163 - 592456 (strand: 1)
Length 294 (nucleotides) / 97 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_4847
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF05016 ParE toxin of type II toxin-antitoxin system, parDE

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3668 Mobilome: prophages, transposons (X) X Plasmid stabilization system protein ParE

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K19092 toxin ParE1/3/4 - -

Protein Sequence

MYKLSKLAEEDIYQIARYTIQQFGVTQAKKYHNDLKQTFELLAKAPWIGRECNWVCNGMRRFEFKKHSIYYLPKNDTLFITRLIHHSIDVDFVDFPK

Flanking regions ( +/- flanking 50bp)

AAGTAAAAATGACATGGATGATATTTTTGCAAGAGCTGAAAAGGACTTAAATGTATAAACTTTCTAAATTAGCAGAAGAAGATATTTACCAAATTGCTCGTTATACTATTCAACAATTTGGAGTAACTCAGGCAAAAAAATATCATAATGATTTAAAACAGACATTTGAGCTACTAGCTAAAGCACCTTGGATTGGACGAGAATGTAATTGGGTGTGTAATGGTATGAGACGATTTGAGTTTAAAAAACATTCAATTTATTATCTACCAAAAAATGATACCTTATTTATTACTCGTCTTATTCATCATTCAATAGATGTTGATTTTGTTGATTTTCCTAAATAAATATTTCATTACTTATTACCAAATATATTGTCCAGTCATATATCCTTTAG