Homologs in group_4034

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4034

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4034

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0C2N3 8.52e-31 106 66 0 80 3 parD Antitoxin ParD Yersinia enterocolitica
A1JUB1 8.52e-31 106 66 0 80 3 parD Antitoxin ParD Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q9ZGW3 1.43e-29 103 65 0 80 3 parD Antitoxin ParD Yersinia pestis
P58093 9.63e-20 78 51 0 68 1 parD Antitoxin ParD Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P58092 1.81e-16 70 45 0 72 3 parD Antitoxin ParD Escherichia coli O157:H7
P67299 3.41e-10 53 38 1 80 3 parD Antitoxin ParD Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WIJ7 3.41e-10 53 38 1 80 1 parD1 Antitoxin ParD1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIJ6 3.41e-10 53 38 1 80 3 parD1 Antitoxin ParD1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9PBR9 1.32e-09 52 41 0 51 3 parD Antitoxin ParD Xylella fastidiosa (strain 9a5c)
P58091 1.72e-08 50 46 0 56 1 parD1 Antitoxin ParD1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9A458 0.000297 39 27 0 74 1 parD4 Antitoxin ParD4 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS02710
Feature type CDS
Gene -
Product type II toxin-antitoxin system ParD family antitoxin
Location 591928 - 592170 (strand: 1)
Length 243 (nucleotides) / 80 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_4034
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF03693 Bacterial antitoxin of ParD toxin-antitoxin type II system and RHH

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3609 Transcription (K) K Transcriptional regulator, contains Arc/MetJ-type RHH (ribbon-helix-helix) DNA-binding domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07746 antitoxin ParD1/3/4 - -

Protein Sequence

MARVTSVTLGEHFNDFVGSMINSGRYGNTSEVIRDALRMMEIREERLQLVRKMVLDGVNSLESKNDMDDIFARAEKDLNV

Flanking regions ( +/- flanking 50bp)

AATTTATTGCTAATGTAGTATTACTAAGTAATACAATGTAGGAAGGGGTTATGGCACGAGTAACGAGTGTAACTTTAGGTGAACACTTCAATGATTTTGTGGGCTCAATGATTAATTCAGGGCGTTATGGAAATACCTCTGAGGTTATTAGAGATGCTTTGCGTATGATGGAAATCAGAGAAGAACGACTCCAATTGGTTCGTAAAATGGTACTAGATGGTGTGAATTCACTAGAAAGTAAAAATGACATGGATGATATTTTTGCAAGAGCTGAAAAGGACTTAAATGTATAAACTTTCTAAATTAGCAGAAGAAGATATTTACCAAATTGCTCGTTATACTA