Homologs in group_4054

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4054

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4054

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P03049 2.45e-05 42 46 0 41 1 mnt Regulatory protein mnt Salmonella phage P22

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS02545
Feature type CDS
Gene -
Product Arc family DNA-binding protein
Location 559095 - 559352 (strand: 1)
Length 258 (nucleotides) / 85 (amino acids)
In genomic island GI55

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_4054
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF03869 Arc-like DNA binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4691 Defense mechanisms (V) V Plasmid stability protein StbC1, contains ribbon-helix-helix domain

Protein Sequence

MSQKNTRIRDITPYSLRMPDTLKEKLMQRASKNGRSLNAEMVMILQSAVDEDNTPKNLNELSQLDPEKFKELFMETIKKMNEGKK

Flanking regions ( +/- flanking 50bp)

ACGAATAATTGACTATATTGTGATATCACAATGACTTTACTGGTGGTTGTATGTCACAAAAAAATACGAGAATAAGAGATATAACGCCTTATAGCCTTAGAATGCCTGATACTCTGAAGGAAAAGTTAATGCAAAGGGCAAGTAAGAATGGGCGATCTCTTAATGCTGAAATGGTTATGATTCTTCAGTCTGCCGTGGATGAGGATAACACCCCTAAAAACTTAAACGAGTTGTCACAGCTTGATCCTGAAAAGTTCAAAGAACTGTTCATGGAAACTATCAAGAAGATGAATGAGGGTAAAAAGTGACTAATATCACATTTTATTTTGTTGTTACTGTATAAAAAACAGGAATGTAA