Homologs in group_3834
1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product | |
|---|---|---|---|---|---|
| F4V73_RS06190 | F4V73_RS06190 | 75.0 | Morganella psychrotolerans | - | DUF1364 domain-containing protein |
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| P68661 | 2.54e-40 | 131 | 62 | 0 | 95 | 1 | ybcO | Putative nuclease YbcO | Escherichia coli (strain K12) |
| P68662 | 2.54e-40 | 131 | 62 | 0 | 95 | 3 | ybcO | Putative nuclease ybcO | Enterobacteria phage 82 |
| Source | Proteus mirabilis HI4320 |
|---|---|
| Locus tag | PMI_RS02410 |
| Feature type | CDS |
| Gene | - |
| Product | DUF1364 domain-containing protein |
| Location | 541061 - 541351 (strand: 1) |
| Length | 291 (nucleotides) / 96 (amino acids) |
| Accession | NC_010554 |
|---|---|
| Length | 4063606 nucleotides |
| Topology | circular |
| Plasmid | False |
| Orthogroup | group_3834 | |
|---|---|---|
| Orthogroup size | 2 | |
| N. genomes | 2 |
| PF07102 | Putative nuclease YbcO |
|---|
MMNLRNEAKGRECQIRIPSVCNGNSETVVLAHYRMSGLCGAGIKSHDLFGAWACSACHDEVDRRTRFTDMEYAKQCHLEGVLRTQAILIQEGKLNV
ACATGATCGTTTTTATTTTAAAGTGATAAAAAATAGTAATCAGGAGGCTCATGATGAATTTACGCAATGAGGCAAAAGGGCGTGAATGTCAGATTAGAATACCTTCAGTTTGTAATGGTAACTCTGAAACGGTTGTTTTAGCCCATTACAGAATGTCAGGTCTTTGTGGCGCCGGAATAAAATCGCATGACTTATTTGGCGCTTGGGCTTGTAGTGCATGTCACGATGAAGTTGATAGACGAACACGATTTACGGATATGGAGTATGCAAAACAATGTCATCTAGAAGGTGTTTTGAGAACGCAAGCCATATTGATCCAAGAAGGGAAGTTGAACGTGTGAAGGTCTTTAATATCGAACCAGTACCTAAACCAAGGATGACTCAGGCTGAT
