Homologs in group_429

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00265 FBDBKF_00265 63.6 Morganella morganii S1 - hypothetical protein
EHELCC_01280 EHELCC_01280 63.6 Morganella morganii S2 - hypothetical protein
NLDBIP_02180 NLDBIP_02180 63.6 Morganella morganii S4 - hypothetical protein
LHKJJB_03695 LHKJJB_03695 63.6 Morganella morganii S3 - hypothetical protein
HKOGLL_03350 HKOGLL_03350 63.6 Morganella morganii S5 - hypothetical protein
F4V73_RS06265 F4V73_RS06265 44.9 Morganella psychrotolerans - hypothetical protein

Distribution of the homologs in the orthogroup group_429

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_429

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS02370
Feature type CDS
Gene -
Product hypothetical protein
Location 535490 - 535690 (strand: -1)
Length 201 (nucleotides) / 66 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_429
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Protein Sequence

MARKALEEANRGRTTEEIWDSIIKPVDETDVLSELIICLKDTPSEHRKKLRLRKPIMPSGEVTARA

Flanking regions ( +/- flanking 50bp)

CTGGTAAGACAAATTCAAAGATGCGTCGTTATATCGCTAGAGGTGAATTAATGGCTCGCAAAGCTTTAGAAGAAGCGAATCGTGGTCGCACTACTGAGGAAATATGGGATTCAATCATTAAGCCAGTCGATGAAACGGATGTATTGTCAGAGTTAATTATTTGTTTAAAGGATACACCTAGTGAACATCGTAAGAAATTACGTCTACGCAAGCCTATTATGCCAAGCGGGGAAGTGACGGCGAGGGCTTGATATGACTAAAATTATCTATCTTGAGAAAGGAAGAAACTCAAAAGCAAGGC