Homologs in group_3879
1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product | |
|---|---|---|---|---|---|
| PMI_RS04415 | PMI_RS04415 | 90.6 | Proteus mirabilis HI4320 | - | hypothetical protein |
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|
| Source | Proteus mirabilis HI4320 |
|---|---|
| Locus tag | PMI_RS02315 |
| Feature type | CDS |
| Gene | - |
| Product | hypothetical protein |
| Location | 530495 - 530689 (strand: -1) |
| Length | 195 (nucleotides) / 64 (amino acids) |
| Accession | NC_010554 |
|---|---|
| Length | 4063606 nucleotides |
| Topology | circular |
| Plasmid | False |
| Orthogroup | group_3879 | |
|---|---|---|
| Orthogroup size | 2 | |
| N. genomes | 1 |
MTITLTTKQIMAMADFVGLKVEPHGLDINDETEYTIEPRKDKETGRVHVFYCTEYPEEGAIQLD
AATTTAAATAGCTCAGGGAATATTTGCAAGGATGCAAACAGGAGATAGATATGACTATTACATTAACAACGAAGCAAATAATGGCTATGGCTGATTTTGTCGGCTTAAAAGTAGAACCTCACGGATTAGATATTAATGATGAGACTGAATACACCATCGAGCCACGTAAAGATAAAGAAACCGGTCGTGTGCATGTATTTTACTGTACTGAATATCCAGAAGAAGGCGCCATTCAGCTGGACTAATTAACTCGCAGGGATGCAATAAGAGGAATGAACATGAGTAAGCAGATGGT
