Homologs in group_4028

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4028

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4028

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P68927 0.000551 38 45 1 40 1 xis Excisionase Escherichia phage HK022
P68926 0.000551 38 45 1 40 4 xis Excisionase Enterobacteria phage 434
P03699 0.000563 38 45 1 40 1 xis Excisionase Escherichia phage lambda

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS02290
Feature type CDS
Gene -
Product excisionase
Location 528035 - 528280 (strand: -1)
Length 246 (nucleotides) / 81 (amino acids)
In genomic island GI54

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_4028
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF07825 Excisionase-like protein

Protein Sequence

MKRITLSEWNNKYFANPRSQRQLSRYIKEGRLYPAPEKVGREYELEPWTILTNDKMVREPQYLMEKINGQKQKCKEQGFTA

Flanking regions ( +/- flanking 50bp)

CGTGGCGCTATGGAAGTTTTTTTAATGATGAAGGATACGGAGAATAATCAATGAAACGAATTACATTATCAGAATGGAATAATAAATATTTCGCTAACCCTAGAAGTCAACGGCAATTATCTCGCTATATAAAGGAAGGTAGGTTATACCCTGCTCCAGAAAAGGTTGGTAGAGAATATGAGTTAGAGCCGTGGACAATTCTAACAAATGACAAAATGGTAAGGGAACCGCAATATTTAATGGAGAAAATTAATGGGCAGAAGCAGAAGTGCAAAGAACAAGGGTTTACCGCCTAACTTGTATTTGCGTAAAGGGATTTACTATTACAGGGATGTAAGAACTAAAA