Homologs in group_4314

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4314

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4314

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P68208 6.79e-25 90 59 0 69 3 yjbJ UPF0337 protein YjbJ Shigella flexneri
P68206 6.79e-25 90 59 0 69 1 yjbJ UPF0337 protein YjbJ Escherichia coli (strain K12)
P68207 6.79e-25 90 59 0 69 3 yjbJ UPF0337 protein YjbJ Escherichia coli O157:H7
Q7CPB2 4.65e-24 88 57 1 70 3 yjbJ UPF0337 protein YjbJ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XEL4 4.65e-24 88 57 1 70 3 yjbJ UPF0337 protein YjbJ Salmonella typhi
Q8FB32 6.52e-23 85 57 0 69 3 yjbJ UPF0337 protein YjbJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q6D9I4 9.69e-22 82 55 0 69 3 ECA0631 UPF0337 protein ECA0631 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6N233 2.54e-20 79 62 0 58 3 RPA4217 UPF0337 protein RPA4217 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q8U6T2 1.28e-18 74 54 0 64 3 Atu4724 UPF0337 protein Atu4724 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q92V27 6.82e-18 72 50 0 66 3 RB0906 UPF0337 protein RB0906 Rhizobium meliloti (strain 1021)
Q89UE4 6.11e-16 67 53 0 58 3 bsl1473 UPF0337 protein bsl1473 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q7UK08 1.61e-14 64 44 1 65 3 RB10934 UPF0337 protein RB10934 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q6MDJ3 4.93e-13 60 54 0 57 3 pc0632 UPF0337 protein pc0632 Protochlamydia amoebophila (strain UWE25)
Q82SA7 8.3e-13 60 49 0 55 3 NE2439 UPF0337 protein NE2439 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q7WGK3 2.14e-12 58 43 0 66 3 BB3586 UPF0337 protein BB3586 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7W5V2 2.14e-12 58 43 0 66 3 BPP3185 UPF0337 protein BPP3185 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7VXL5 2.14e-12 58 43 0 66 3 BP1738 UPF0337 protein BP1738 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q98PA0 2.42e-12 58 62 0 45 3 msl9551 UPF0337 protein msl9551 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8PFH4 6.22e-12 57 46 0 64 3 XAC4007 UPF0337 protein XAC4007 Xanthomonas axonopodis pv. citri (strain 306)
Q8P3Z3 1.98e-11 56 45 0 64 3 XCC3924 UPF0337 protein XCC3924 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q9HV61 4.93e-11 55 44 0 61 1 PA4738 UPF0337 protein PA4738 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7USI7 8.5e-08 48 42 1 57 3 RB4474 UPF0337 protein RB4474 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q6MI44 2.99e-05 41 37 1 58 3 Bd3330 UPF0337 protein Bd3330 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q8PR66 0.000341 37 34 0 58 3 XAC0100 UPF0337 protein XAC0100 Xanthomonas axonopodis pv. citri (strain 306)
Q8PEB1 0.001 37 36 0 55 3 XCC0070 UPF0337 protein XCC0070 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS01725
Feature type CDS
Gene -
Product CsbD family protein
Location 409163 - 409375 (strand: -1)
Length 213 (nucleotides) / 70 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_4314
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF05532 CsbD-like

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3237 Function unknown (S) S Uncharacterized conserved protein YjbJ, UPF0337 family

Protein Sequence

MLNNKASGDWNLFKGKVKEKWGKLTHDELDIIEGTREQLIGKLQEHYGYSYDEAKKEVLEWEGSNPYPWK

Flanking regions ( +/- flanking 50bp)

CTTCTACACTTAATAGTGTCAATAAACAGAAATAAGTTAGGTGGAATAAGATGTTAAATAATAAAGCTTCTGGTGACTGGAATTTATTTAAAGGAAAAGTGAAAGAAAAATGGGGAAAACTCACCCATGATGAACTGGATATTATTGAAGGAACCAGAGAGCAACTGATAGGGAAACTCCAAGAGCATTATGGCTATTCTTATGATGAGGCAAAAAAAGAAGTATTAGAGTGGGAAGGCAGTAACCCTTATCCTTGGAAGTAGCAGCGACTTAATCACAGTATTAAAAAGCTTAATATCCTTATCTGAAAGCG