Homologs in group_4301

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4301

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4301

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
C0H423 4.41e-22 83 66 0 68 4 yozV Uncharacterized membrane protein YozV Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS01185
Feature type CDS
Gene -
Product TM2 domain-containing protein
Location 292101 - 292313 (strand: -1)
Length 213 (nucleotides) / 70 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_4301
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF05154 TM2 domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2314 General function prediction only (R) R Uncharacterized membrane protein YozV, TM2 domain, contains pTyr

Protein Sequence

MNDKNKLAAALLAIFLGGLGIHKFYLRKVGMGILYLIFCWTGIPAIIGFIEGIYYLCISDQTFNDKYNRN

Flanking regions ( +/- flanking 50bp)

ATCAATATTCATGATTAAAAACCAATGATTGGTAATAGGAGCAGATATTAATGAATGATAAAAATAAGCTAGCAGCCGCATTATTAGCTATTTTTCTTGGTGGGCTAGGAATACATAAATTCTATCTTCGTAAAGTAGGAATGGGGATTTTATATCTCATTTTTTGCTGGACGGGGATACCCGCTATTATCGGTTTTATTGAAGGAATTTATTATCTGTGTATTTCAGACCAAACCTTTAATGACAAATATAACCGAAACTAAATAGCCCAATACCATCGTATCTAGTGCTAACAACCAACAAAAAAACCCGC