Homologs in group_337

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13490 FBDBKF_13490 31.7 Morganella morganii S1 htpX protease HtpX
EHELCC_08605 EHELCC_08605 31.7 Morganella morganii S2 htpX protease HtpX
NLDBIP_08930 NLDBIP_08930 31.7 Morganella morganii S4 htpX protease HtpX
LHKJJB_05335 LHKJJB_05335 31.7 Morganella morganii S3 htpX protease HtpX
HKOGLL_05580 HKOGLL_05580 31.7 Morganella morganii S5 htpX protease HtpX
F4V73_RS03265 F4V73_RS03265 32.0 Morganella psychrotolerans htpX protease HtpX
PMI_RS04945 PMI_RS04945 30.0 Proteus mirabilis HI4320 htpX protease HtpX

Distribution of the homologs in the orthogroup group_337

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_337

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q17WX4 8.74e-74 233 40 6 319 3 htpX Protease HtpX homolog Helicobacter acinonychis (strain Sheeba)
Q9ZKS4 3.13e-72 228 41 8 320 3 htpX Protease HtpX homolog Helicobacter pylori (strain J99 / ATCC 700824)
B2UU75 2.13e-71 226 40 6 318 3 htpX Protease HtpX homolog Helicobacter pylori (strain Shi470)
O25582 8.4e-71 225 40 6 318 3 htpX Protease HtpX homolog Helicobacter pylori (strain ATCC 700392 / 26695)
Q1WV87 3.1e-40 145 37 4 226 3 htpX Protease HtpX homolog Ligilactobacillus salivarius (strain UCC118)
B8E160 7.46e-36 134 34 4 252 3 htpX Protease HtpX homolog Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
Q03DY7 1.45e-35 133 35 4 222 3 htpX Protease HtpX homolog Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q8R936 3.43e-35 132 34 5 269 3 htpX Protease HtpX homolog Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A1T3T1 5.94e-35 131 33 11 311 3 htpX Protease HtpX homolog Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q64V41 1.38e-34 131 30 9 326 3 htpX Protease HtpX homolog Bacteroides fragilis (strain YCH46)
Q5LE03 2.66e-34 130 30 9 326 3 htpX Protease HtpX homolog Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A3CLJ7 4.32e-34 129 27 4 297 3 htpX Protease HtpX homolog Streptococcus sanguinis (strain SK36)
Q8Y8E1 2.68e-33 127 36 4 225 3 htpX Protease HtpX homolog Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B0KB34 3.81e-33 127 30 6 311 3 htpX Protease HtpX homolog Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B8DEH2 4.57e-33 127 30 9 317 3 htpX Protease HtpX homolog Listeria monocytogenes serotype 4a (strain HCC23)
Q48V70 5.48e-33 126 30 8 306 3 htpX Protease HtpX homolog Streptococcus pyogenes serotype M28 (strain MGAS6180)
B0K4Z5 6.29e-33 126 30 6 311 3 htpX Protease HtpX homolog Thermoanaerobacter sp. (strain X514)
Q92D58 8.02e-33 126 31 9 316 3 htpX Protease HtpX homolog Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A4T190 1.27e-32 125 31 8 293 3 htpX Protease HtpX homolog Mycolicibacterium gilvum (strain PYR-GCK)
C0MG49 1.96e-32 125 34 3 215 3 htpX Protease HtpX homolog Streptococcus equi subsp. zooepidemicus (strain H70)
B4U4T2 1.96e-32 125 34 3 215 3 htpX Protease HtpX homolog Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
A0AH81 2.05e-32 125 30 10 316 3 htpX Protease HtpX homolog Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B0VDQ0 2.07e-32 125 34 7 235 3 htpX Protease HtpX Acinetobacter baumannii (strain AYE)
A3M830 2.07e-32 125 34 7 235 3 htpX Protease HtpX Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VT08 2.07e-32 125 34 7 235 3 htpX Protease HtpX Acinetobacter baumannii (strain SDF)
B2HXB0 2.07e-32 125 34 7 235 3 htpX Protease HtpX Acinetobacter baumannii (strain ACICU)
B7I612 2.07e-32 125 34 7 235 3 htpX Protease HtpX Acinetobacter baumannii (strain AB0057)
B7GY42 2.07e-32 125 34 7 235 3 htpX Protease HtpX Acinetobacter baumannii (strain AB307-0294)
P9WHS5 3.23e-32 124 33 9 302 1 htpX Protease HtpX homolog Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHS4 3.23e-32 124 33 9 302 3 htpX Protease HtpX homolog Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5TZU3 3.23e-32 124 33 9 302 3 htpX Protease HtpX homolog Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AKP3 3.23e-32 124 33 9 302 3 htpX Protease HtpX homolog Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KG40 3.23e-32 124 33 9 302 3 htpX Protease HtpX homolog Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P65816 3.23e-32 124 33 9 302 3 htpX Protease HtpX homolog Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
O31657 3.37e-32 124 34 6 236 3 htpX Protease HtpX homolog Bacillus subtilis (strain 168)
Q93D93 3.37e-32 124 33 4 216 3 htpX Protease HtpX homolog Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q5FMS7 3.44e-32 124 29 5 280 3 htpX Protease HtpX homolog Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
P0DD31 3.82e-32 124 30 8 306 3 htpX Protease HtpX homolog Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DD30 3.82e-32 124 30 8 306 3 htpX Protease HtpX homolog Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
A2RGB7 3.98e-32 124 30 8 306 3 htpX Protease HtpX homolog Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J8D6 3.98e-32 124 30 8 306 3 htpX Protease HtpX homolog Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JII1 3.98e-32 124 30 8 306 3 htpX Protease HtpX homolog Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JND2 3.98e-32 124 30 8 306 3 htpX Protease HtpX homolog Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q8P2K0 3.98e-32 124 30 8 306 3 htpX Protease HtpX homolog Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q9A1D5 3.98e-32 124 30 8 306 3 htpX Protease HtpX homolog Streptococcus pyogenes serotype M1
Q5XDS0 4.15e-32 124 30 8 306 3 htpX Protease HtpX homolog Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
A7Z3W3 5.11e-32 124 33 5 236 3 htpX Protease HtpX homolog Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B9DTP5 5.44e-32 124 33 5 244 3 htpX Protease HtpX homolog Streptococcus uberis (strain ATCC BAA-854 / 0140J)
B5XJV3 5.73e-32 124 30 8 306 3 htpX Protease HtpX homolog Streptococcus pyogenes serotype M49 (strain NZ131)
Q6F8Q1 1.04e-31 123 33 7 236 3 htpX Protease HtpX Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q721K3 1.06e-31 123 35 4 225 3 htpX Protease HtpX homolog Listeria monocytogenes serotype 4b (strain F2365)
C1L1N4 1.06e-31 123 35 4 225 3 htpX Protease HtpX homolog Listeria monocytogenes serotype 4b (strain CLIP80459)
Q03T13 1.61e-31 122 34 5 222 3 htpX Protease HtpX homolog Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
C0M819 1.71e-31 122 33 3 215 3 htpX Protease HtpX homolog Streptococcus equi subsp. equi (strain 4047)
A0PLW0 2.09e-31 122 33 6 262 3 htpX Protease HtpX homolog Mycobacterium ulcerans (strain Agy99)
B2HRQ7 2.32e-31 122 33 7 268 3 htpX Protease HtpX homolog Mycobacterium marinum (strain ATCC BAA-535 / M)
Q0VQC0 4.14e-31 121 33 7 238 3 htpX Protease HtpX Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A8I246 2.59e-30 119 36 9 220 3 htpX Protease HtpX homolog Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q38V59 2.8e-30 119 30 8 310 3 htpX Protease HtpX homolog Latilactobacillus sakei subsp. sakei (strain 23K)
A0QRJ0 3.21e-30 119 32 10 308 3 htpX Protease HtpX homolog Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
B1MY16 3.24e-30 119 31 3 220 3 htpX Protease HtpX homolog Leuconostoc citreum (strain KM20)
A8YWL7 3.75e-30 119 28 5 280 3 htpX Protease HtpX homolog Lactobacillus helveticus (strain DPC 4571)
C6A335 4.03e-30 119 32 6 250 3 htpX Protease HtpX homolog Thermococcus sibiricus (strain DSM 12597 / MM 739)
Q04WP4 1.6e-29 117 32 12 312 3 htpX Protease HtpX homolog Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04NG2 1.6e-29 117 32 12 312 3 htpX Protease HtpX homolog Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q1BDZ2 1.87e-29 117 31 10 298 3 htpX Protease HtpX homolog Mycobacterium sp. (strain MCS)
A1UAZ4 1.87e-29 117 31 10 298 3 htpX Protease HtpX homolog Mycobacterium sp. (strain KMS)
A3PUK0 1.87e-29 117 31 10 298 3 htpX Protease HtpX homolog Mycobacterium sp. (strain JLS)
B2GA61 2.77e-29 116 28 7 318 3 htpX Protease HtpX homolog Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q8EXN4 2.8e-29 116 32 12 307 3 htpX Protease HtpX homolog Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q75FP1 2.8e-29 116 32 12 307 3 htpX Protease HtpX homolog Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q9CBA4 3.79e-29 116 33 7 262 3 htpX Protease HtpX homolog Mycobacterium leprae (strain TN)
B8ZSY8 3.79e-29 116 33 7 262 3 htpX Protease HtpX homolog Mycobacterium leprae (strain Br4923)
Q1QXV6 5.04e-29 116 32 11 276 3 htpX Protease HtpX Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A0LHQ9 9.13e-29 115 32 9 259 3 htpX Protease HtpX homolog Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q88Z48 1.71e-28 114 28 11 316 3 htpX Protease HtpX homolog Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q65TG9 2.01e-28 114 35 10 232 3 htpX Protease HtpX Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
C1CR23 2.83e-28 114 30 6 248 3 htpX Protease HtpX homolog Streptococcus pneumoniae (strain Taiwan19F-14)
C1CEN8 3.52e-28 114 30 6 248 3 htpX Protease HtpX homolog Streptococcus pneumoniae (strain JJA)
B8ZJU7 3.52e-28 114 30 6 248 3 htpX Protease HtpX homolog Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
C1C7R3 3.52e-28 114 30 6 248 3 htpX Protease HtpX homolog Streptococcus pneumoniae (strain 70585)
B5E520 3.52e-28 114 30 6 248 3 htpX Protease HtpX homolog Streptococcus pneumoniae serotype 19F (strain G54)
Q97QD6 3.59e-28 114 30 6 248 3 htpX Protease HtpX homolog Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A8FCF7 3.63e-28 114 29 12 315 3 htpX Protease HtpX homolog Bacillus pumilus (strain SAFR-032)
B9JUJ0 4.08e-28 114 30 7 263 3 htpX Protease HtpX homolog Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q8UBM5 4.52e-28 114 29 6 259 3 htpX Protease HtpX homolog Agrobacterium fabrum (strain C58 / ATCC 33970)
C1CL18 4.74e-28 113 30 6 248 3 htpX Protease HtpX homolog Streptococcus pneumoniae (strain P1031)
Q5QZ20 5.14e-28 113 31 9 236 3 htpX Protease HtpX Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B8FG65 5.56e-28 113 31 9 285 3 htpX Protease HtpX homolog Desulfatibacillum aliphaticivorans
Q4QMJ9 5.71e-28 112 30 9 255 3 htpX Protease HtpX Haemophilus influenzae (strain 86-028NP)
A1BGS5 5.93e-28 113 33 10 287 3 htpX Protease HtpX homolog Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
P44840 6.14e-28 112 30 9 255 3 htpX Protease HtpX Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHK2 6.14e-28 112 30 9 255 3 htpX Protease HtpX Haemophilus influenzae (strain PittGG)
A5UE05 8.54e-28 112 30 9 255 3 htpX Protease HtpX Haemophilus influenzae (strain PittEE)
B5YKM8 9.38e-28 112 30 8 252 3 htpX Protease HtpX homolog Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q2SJQ5 1.23e-27 112 32 5 226 3 htpX Protease HtpX Hahella chejuensis (strain KCTC 2396)
B2FN30 1.3e-27 112 33 7 224 3 htpX Protease HtpX Stenotrophomonas maltophilia (strain K279a)
P57846 1.3e-27 112 32 8 232 3 htpX Protease HtpX Pasteurella multocida (strain Pm70)
B4SQB7 1.5e-27 112 33 7 224 3 htpX Protease HtpX Stenotrophomonas maltophilia (strain R551-3)
Q5WZY7 2.12e-27 111 32 6 225 3 htpX Protease HtpX Legionella pneumophila (strain Lens)
Q8DPH5 2.2e-27 111 30 6 248 3 htpX Protease HtpX homolog Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B1IC73 2.2e-27 111 30 6 248 3 htpX Protease HtpX homolog Streptococcus pneumoniae (strain Hungary19A-6)
Q04K41 2.2e-27 111 30 6 248 3 htpX Protease HtpX homolog Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q5X8K6 3.27e-27 110 32 6 225 3 htpX Protease HtpX Legionella pneumophila (strain Paris)
B0UUC9 3.29e-27 110 32 9 242 3 htpX Protease HtpX Histophilus somni (strain 2336)
A5IA60 3.74e-27 110 32 6 225 3 htpX Protease HtpX Legionella pneumophila (strain Corby)
B3QED3 3.82e-27 111 34 9 222 3 htpX Protease HtpX homolog Rhodopseudomonas palustris (strain TIE-1)
Q8E3T2 3.93e-27 110 29 7 296 3 htpX Protease HtpX homolog Streptococcus agalactiae serotype III (strain NEM316)
B8GTV4 4.64e-27 110 31 8 232 3 htpX Protease HtpX Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q03YG9 4.87e-27 110 31 5 226 3 htpX Protease HtpX homolog Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q8DY66 5.03e-27 110 29 7 296 3 htpX Protease HtpX homolog Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3JZQ9 5.03e-27 110 29 7 296 3 htpX Protease HtpX homolog Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q1MA32 5.04e-27 111 29 9 311 3 htpX Protease HtpX homolog Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B3PS39 5.07e-27 111 28 9 312 3 htpX Protease HtpX homolog Rhizobium etli (strain CIAT 652)
B5YDL5 5.19e-27 110 35 5 221 3 htpX Protease HtpX homolog Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
B3PJ06 5.21e-27 110 34 9 228 3 htpX Protease HtpX Cellvibrio japonicus (strain Ueda107)
Q9K9E6 5.39e-27 110 31 5 235 3 htpX Protease HtpX homolog Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A4SEH5 5.44e-27 110 32 4 224 3 htpX Protease HtpX homolog Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q8U1S0 5.86e-27 110 30 7 276 3 htpX Protease HtpX homolog Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
B0BPX8 5.86e-27 110 31 10 260 3 htpX Protease HtpX Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H1S0 5.86e-27 110 31 10 260 3 htpX Protease HtpX Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N147 5.86e-27 110 31 10 260 3 htpX Protease HtpX Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q5ZZ31 9.09e-27 109 32 5 214 3 htpX Protease HtpX Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
B3DX74 9.75e-27 110 33 8 231 3 htpX Protease HtpX homolog Methylacidiphilum infernorum (isolate V4)
A1VSW7 1.01e-26 109 33 8 230 3 htpX Protease HtpX homolog Polaromonas naphthalenivorans (strain CJ2)
Q7VWH2 1.07e-26 109 29 8 272 3 htpX Protease HtpX homolog Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W7R8 1.07e-26 109 29 8 272 3 htpX Protease HtpX homolog Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WL55 1.07e-26 109 29 8 272 3 htpX Protease HtpX homolog Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B3EPQ3 1.1e-26 110 32 8 237 3 htpX Protease HtpX homolog Chlorobium phaeobacteroides (strain BS1)
Q65KL0 1.17e-26 109 32 6 234 3 htpX Protease HtpX homolog Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A1KT72 1.19e-26 109 34 6 223 3 htpX Protease HtpX homolog Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9K006 1.19e-26 109 34 6 223 3 htpX Protease HtpX homolog Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9M3Q1 1.24e-26 109 34 6 223 3 htpX Protease HtpX homolog Neisseria meningitidis serogroup C (strain 053442)
B4RKA0 1.24e-26 109 34 6 223 3 htpX Protease HtpX homolog Neisseria gonorrhoeae (strain NCCP11945)
Q5F9J4 1.24e-26 109 34 6 223 3 htpX Protease HtpX homolog Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q9JV19 1.35e-26 109 34 6 223 3 htpX Protease HtpX homolog Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q15YY4 1.39e-26 109 30 10 271 3 htpX Protease HtpX Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q82UR0 1.41e-26 109 31 7 226 3 htpX Protease HtpX homolog Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q9UZK3 1.51e-26 109 31 7 276 3 htpX Protease HtpX homolog Pyrococcus abyssi (strain GE5 / Orsay)
Q13D27 1.61e-26 109 36 10 222 3 htpX Protease HtpX homolog Rhodopseudomonas palustris (strain BisB5)
B5ZV34 2.13e-26 109 28 9 312 3 htpX Protease HtpX homolog Rhizobium leguminosarum bv. trifolii (strain WSM2304)
B4S7I8 2.44e-26 108 31 7 235 3 htpX Protease HtpX homolog Prosthecochloris aestuarii (strain DSM 271 / SK 413)
A4VMI8 2.6e-26 108 32 6 225 3 htpX Protease HtpX Stutzerimonas stutzeri (strain A1501)
Q2K2T3 2.66e-26 109 29 9 312 3 htpX Protease HtpX homolog Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
C0QEI1 2.69e-26 108 29 9 316 3 htpX Protease HtpX homolog Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q0AFV3 2.9e-26 108 31 7 228 3 htpX Protease HtpX homolog Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q6G5S9 3.42e-26 109 31 9 282 3 htpX Protease HtpX homolog Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
B8F543 3.95e-26 108 29 7 244 3 htpX Protease HtpX Glaesserella parasuis serovar 5 (strain SH0165)
B3ED81 4.43e-26 108 32 9 280 3 htpX Protease HtpX homolog Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q6FYG1 4.55e-26 109 32 10 282 3 htpX Protease HtpX homolog Bartonella quintana (strain Toulouse)
O30795 5.44e-26 107 27 4 259 2 htpX Protease HtpX homolog Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q8K9M1 5.66e-26 107 30 13 301 3 htpX Protease HtpX Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A7GZM4 6.86e-26 107 34 7 222 3 htpX Protease HtpX homolog Campylobacter curvus (strain 525.92)
A1WYI3 8.45e-26 107 30 13 310 3 htpX Protease HtpX Halorhodospira halophila (strain DSM 244 / SL1)
Q5M0E9 9.71e-26 107 28 6 266 3 htpX Protease HtpX homolog Streptococcus thermophilus (strain CNRZ 1066)
A4XVB4 1.09e-25 107 30 11 299 3 htpX Protease HtpX Pseudomonas mendocina (strain ymp)
Q3SW84 1.12e-25 107 28 11 317 3 htpX Protease HtpX homolog Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
B2G5L7 1.12e-25 107 32 4 220 3 htpX Protease HtpX homolog Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VI38 1.12e-25 107 32 4 220 3 htpX Protease HtpX homolog Limosilactobacillus reuteri (strain DSM 20016)
C3MAR8 1.64e-25 107 34 8 223 3 htpX Protease HtpX homolog Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q5GZ91 2.1e-25 106 28 10 294 3 htpX Protease HtpX Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P2A1 2.1e-25 106 28 10 294 3 htpX Protease HtpX Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q87A36 2.24e-25 106 30 7 232 3 htpX Protease HtpX Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2IA62 2.24e-25 106 30 7 232 3 htpX Protease HtpX Xylella fastidiosa (strain M23)
A9ITD6 2.37e-25 106 29 10 270 3 htpX Protease HtpX homolog Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
B0RS04 2.47e-25 105 30 7 230 3 htpX Protease HtpX Xanthomonas campestris pv. campestris (strain B100)
Q8P8F0 2.6e-25 105 30 7 230 3 htpX Protease HtpX Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UVN7 2.6e-25 105 30 7 230 3 htpX Protease HtpX Xanthomonas campestris pv. campestris (strain 8004)
Q03LB2 3.11e-25 105 27 6 266 3 htpX Protease HtpX homolog Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q3B410 4.39e-25 105 31 4 222 3 htpX Protease HtpX homolog Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
A1TV68 4.67e-25 105 32 7 221 3 htpX Protease HtpX homolog Paracidovorax citrulli (strain AAC00-1)
Q8EDL5 4.85e-25 105 32 7 232 3 htpX Protease HtpX Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q2NTD3 5.83e-25 105 29 7 229 3 htpX Protease HtpX Sodalis glossinidius (strain morsitans)
O58997 5.93e-25 105 30 8 258 3 htpX Protease HtpX homolog Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
A1AZW2 6.21e-25 105 30 8 266 3 htpX Protease HtpX homolog Paracoccus denitrificans (strain Pd 1222)
Q11CT7 8.2e-25 105 34 8 219 3 htpX Protease HtpX homolog Chelativorans sp. (strain BNC1)
Q21ST3 8.28e-25 104 30 7 226 3 htpX Protease HtpX homolog Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A1UR06 8.72e-25 105 30 7 282 3 htpX Protease HtpX homolog Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
A7IBA0 8.95e-25 105 33 7 218 3 htpX Protease HtpX homolog Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
B2SHQ4 9.93e-25 104 28 10 294 3 htpX Protease HtpX Xanthomonas oryzae pv. oryzae (strain PXO99A)
A7ZCL2 1e-24 104 30 9 312 3 htpX Protease HtpX homolog Campylobacter concisus (strain 13826)
Q3BSD6 1.03e-24 104 29 13 305 3 htpX Protease HtpX Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
A1WC76 1.07e-24 104 30 8 237 3 htpX Protease HtpX homolog Acidovorax sp. (strain JS42)
A6TB00 1.26e-24 104 30 8 233 3 htpX Protease HtpX Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A4WBI8 1.48e-24 103 31 8 232 3 htpX Protease HtpX Enterobacter sp. (strain 638)
B9JEV2 1.52e-24 104 33 7 223 3 htpX Protease HtpX homolog Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q6D4G3 1.74e-24 103 32 9 229 3 htpX Protease HtpX Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q9I013 1.75e-24 103 28 8 293 3 htpX Protease HtpX Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02NZ3 1.75e-24 103 28 8 293 3 htpX Protease HtpX Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UUZ6 1.75e-24 103 28 8 293 3 htpX Protease HtpX Pseudomonas aeruginosa (strain LESB58)
A6V3R0 1.75e-24 103 28 8 293 3 htpX Protease HtpX Pseudomonas aeruginosa (strain PA7)
Q8FYQ1 1.91e-24 104 30 6 260 3 htpX Protease HtpX homolog Brucella suis biovar 1 (strain 1330)
A9WWT8 1.91e-24 104 30 6 260 3 htpX Protease HtpX homolog Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VSF5 1.91e-24 104 30 6 260 3 htpX Protease HtpX homolog Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A9M851 1.91e-24 104 30 6 260 3 htpX Protease HtpX homolog Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
B4SCH3 2.05e-24 103 30 4 226 3 htpX Protease HtpX homolog Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
B0U5X0 2.06e-24 103 30 7 232 3 htpX Protease HtpX Xylella fastidiosa (strain M12)
A7MKG5 2.13e-24 103 29 11 285 3 htpX Protease HtpX Cronobacter sakazakii (strain ATCC BAA-894)
A6WXV6 2.2e-24 103 30 6 260 3 htpX Protease HtpX homolog Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q3JE43 2.35e-24 103 30 12 280 3 htpX Protease HtpX Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q8PJX8 2.41e-24 103 29 13 305 3 htpX Protease HtpX Xanthomonas axonopodis pv. citri (strain 306)
Q98ET0 2.48e-24 104 33 6 218 3 htpX Protease HtpX homolog Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8THH5 2.79e-24 103 29 9 265 3 htpX1 Protease HtpX homolog 1 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q2KZ03 2.81e-24 103 29 9 277 3 htpX Protease HtpX homolog Bordetella avium (strain 197N)
A1RIL6 4.11e-24 102 31 7 232 3 htpX Protease HtpX Shewanella sp. (strain W3-18-1)
A4Y7X2 4.11e-24 102 31 7 232 3 htpX Protease HtpX Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B2VJ57 4.13e-24 102 32 7 228 3 htpX Protease HtpX Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A8AFM2 4.67e-24 102 31 8 232 3 htpX Protease HtpX Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A6Q7D4 5.09e-24 102 32 7 229 3 htpX Protease HtpX homolog Sulfurovum sp. (strain NBC37-1)
A4G729 5.5e-24 102 31 7 258 3 htpX Protease HtpX homolog Herminiimonas arsenicoxydans
B7LPL6 5.61e-24 102 31 8 232 3 htpX Protease HtpX Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A0KID0 6.13e-24 102 31 8 235 3 htpX Protease HtpX Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
C4LDD1 6.24e-24 102 31 9 231 3 htpX Protease HtpX Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q7VNX2 6.27e-24 102 30 9 246 3 htpX Protease HtpX Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A4SPR3 6.52e-24 102 31 8 235 3 htpX Protease HtpX Aeromonas salmonicida (strain A449)
Q8YJ50 6.7e-24 102 30 6 260 3 htpX Protease HtpX homolog Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RF64 6.7e-24 102 30 6 260 3 htpX Protease HtpX homolog Brucella melitensis biotype 2 (strain ATCC 23457)
A0KY72 7.12e-24 102 31 7 232 3 htpX Protease HtpX Shewanella sp. (strain ANA-3)
Q0AAR8 8.31e-24 102 31 13 273 3 htpX Protease HtpX Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q57B74 9.25e-24 102 29 6 260 3 htpX Protease HtpX homolog Brucella abortus biovar 1 (strain 9-941)
Q2YLH3 9.25e-24 102 29 6 260 3 htpX Protease HtpX homolog Brucella abortus (strain 2308)
B2S7N7 9.25e-24 102 29 6 260 3 htpX Protease HtpX homolog Brucella abortus (strain S19)
Q5M4Z6 9.36e-24 102 28 4 263 3 htpX Protease HtpX homolog Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q9PA93 1.01e-23 101 30 7 232 2 htpX Protease HtpX Xylella fastidiosa (strain 9a5c)
A1JM73 1.02e-23 101 32 10 234 3 htpX Protease HtpX Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A9IZD8 1.04e-23 102 30 11 291 3 htpX Protease HtpX homolog Bartonella tribocorum (strain CIP 105476 / IBS 506)
B7USK6 1.06e-23 101 31 8 232 3 htpX Protease HtpX Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q8G6T7 1.12e-23 102 31 8 260 3 htpX Protease HtpX homolog Bifidobacterium longum (strain NCC 2705)
B9MFV5 1.13e-23 101 29 8 237 3 htpX Protease HtpX homolog Acidovorax ebreus (strain TPSY)
Q6AMM5 1.14e-23 101 29 7 227 3 htpX Protease HtpX homolog Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A6SXH1 1.15e-23 101 29 7 257 3 htpX Protease HtpX homolog Janthinobacterium sp. (strain Marseille)
Q0HTZ7 1.2e-23 101 31 7 232 3 htpX Protease HtpX Shewanella sp. (strain MR-7)
Q0HHP5 1.2e-23 101 31 7 232 3 htpX Protease HtpX Shewanella sp. (strain MR-4)
A5WHL4 1.3e-23 101 29 8 231 3 htpX Protease HtpX Psychrobacter sp. (strain PRwf-1)
Q8D396 1.34e-23 101 30 9 246 3 htpX Protease HtpX Wigglesworthia glossinidia brevipalpis
P65817 1.35e-23 101 31 8 232 3 htpX Protease HtpX Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P65818 1.35e-23 101 31 8 232 3 htpX Protease HtpX Salmonella typhi
B4TY12 1.35e-23 101 31 8 232 3 htpX Protease HtpX Salmonella schwarzengrund (strain CVM19633)
B5BHB2 1.35e-23 101 31 8 232 3 htpX Protease HtpX Salmonella paratyphi A (strain AKU_12601)
C0Q2Z1 1.35e-23 101 31 8 232 3 htpX Protease HtpX Salmonella paratyphi C (strain RKS4594)
Q5PHN9 1.35e-23 101 31 8 232 3 htpX Protease HtpX Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SV83 1.35e-23 101 31 8 232 3 htpX Protease HtpX Salmonella newport (strain SL254)
B4TKH4 1.35e-23 101 31 8 232 3 htpX Protease HtpX Salmonella heidelberg (strain SL476)
B5R8V8 1.35e-23 101 31 8 232 3 htpX Protease HtpX Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R2S7 1.35e-23 101 31 8 232 3 htpX Protease HtpX Salmonella enteritidis PT4 (strain P125109)
B5FTJ0 1.35e-23 101 31 8 232 3 htpX Protease HtpX Salmonella dublin (strain CT_02021853)
Q57NG5 1.35e-23 101 31 8 232 3 htpX Protease HtpX Salmonella choleraesuis (strain SC-B67)
A9MNI0 1.35e-23 101 31 8 232 3 htpX Protease HtpX Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F3P9 1.35e-23 101 31 8 232 3 htpX Protease HtpX Salmonella agona (strain SL483)
Q48FR0 1.45e-23 101 31 8 232 3 htpX Protease HtpX Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
C5CML1 1.7e-23 100 29 8 230 3 htpX Protease HtpX homolog Variovorax paradoxus (strain S110)
B5XQ41 1.76e-23 100 30 8 233 3 htpX Protease HtpX Klebsiella pneumoniae (strain 342)
Q9F2V2 1.8e-23 100 30 8 250 3 htpX2 Protease HtpX homolog 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
C6DFY1 1.88e-23 100 32 9 229 3 htpX Protease HtpX Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q0BWV3 2.12e-23 100 33 6 203 3 htpX Protease HtpX homolog Hyphomonas neptunium (strain ATCC 15444)
Q12MB4 2.25e-23 100 31 7 231 3 htpX Protease HtpX Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q1QRL0 2.27e-23 100 34 8 223 3 htpX Protease HtpX homolog Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q885Q3 2.29e-23 100 31 8 231 3 htpX Protease HtpX Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q92KX3 2.61e-23 101 33 6 218 3 htpX Protease HtpX homolog Rhizobium meliloti (strain 1021)
Q3Z2G8 2.66e-23 100 31 8 232 3 htpX Protease HtpX Shigella sonnei (strain Ss046)
P65814 2.66e-23 100 31 8 232 3 htpX Protease HtpX Shigella flexneri
Q0T522 2.66e-23 100 31 8 232 3 htpX Protease HtpX Shigella flexneri serotype 5b (strain 8401)
Q32F28 2.66e-23 100 31 8 232 3 htpX Protease HtpX Shigella dysenteriae serotype 1 (strain Sd197)
Q321Y6 2.66e-23 100 31 8 232 3 htpX Protease HtpX Shigella boydii serotype 4 (strain Sb227)
B2U471 2.66e-23 100 31 8 232 3 htpX Protease HtpX Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RAV8 2.66e-23 100 31 8 232 3 htpX Protease HtpX Escherichia coli (strain UTI89 / UPEC)
B1LD43 2.66e-23 100 31 8 232 3 htpX Protease HtpX Escherichia coli (strain SMS-3-5 / SECEC)
B6IBQ7 2.66e-23 100 31 8 232 3 htpX Protease HtpX Escherichia coli (strain SE11)
B7NBH7 2.66e-23 100 31 8 232 3 htpX Protease HtpX Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B1J0Q9 2.66e-23 100 31 8 232 3 htpX Protease HtpX Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P65812 2.66e-23 100 31 8 232 3 htpX Protease HtpX Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TH03 2.66e-23 100 31 8 232 3 htpX Protease HtpX Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABZ5 2.66e-23 100 31 8 232 3 htpX Protease HtpX Escherichia coli O1:K1 / APEC
A8A127 2.66e-23 100 31 8 232 3 htpX Protease HtpX Escherichia coli O9:H4 (strain HS)
B7M2A5 2.66e-23 100 31 8 232 3 htpX Protease HtpX Escherichia coli O8 (strain IAI1)
B7MVV9 2.66e-23 100 31 8 232 3 htpX Protease HtpX Escherichia coli O81 (strain ED1a)
B7NS90 2.66e-23 100 31 8 232 3 htpX Protease HtpX Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YQX2 2.66e-23 100 31 8 232 3 htpX Protease HtpX Escherichia coli O157:H7 (strain EC4115 / EHEC)
P65813 2.66e-23 100 31 8 232 2 htpX Protease HtpX Escherichia coli O157:H7
B7L7N1 2.66e-23 100 31 8 232 3 htpX Protease HtpX Escherichia coli (strain 55989 / EAEC)
B7MBN6 2.66e-23 100 31 8 232 3 htpX Protease HtpX Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZMV2 2.66e-23 100 31 8 232 3 htpX Protease HtpX Escherichia coli O139:H28 (strain E24377A / ETEC)
A8EV91 3.31e-23 100 30 6 235 3 htpX Protease HtpX homolog Aliarcobacter butzleri (strain RM4018)
Q4ZQC4 3.34e-23 100 31 8 232 3 htpX Protease HtpX Pseudomonas syringae pv. syringae (strain B728a)
Q2RKK7 4.24e-23 100 32 9 259 3 htpX Protease HtpX homolog Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
B1JIC9 4.69e-23 99 32 10 234 3 htpX Protease HtpX Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q669V7 4.69e-23 99 32 10 234 3 htpX Protease HtpX Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TLG5 4.69e-23 99 32 10 234 3 htpX Protease HtpX Yersinia pestis (strain Pestoides F)
Q1CIC7 4.69e-23 99 32 10 234 3 htpX Protease HtpX Yersinia pestis bv. Antiqua (strain Nepal516)
A9R0E2 4.69e-23 99 32 10 234 3 htpX Protease HtpX Yersinia pestis bv. Antiqua (strain Angola)
Q8ZFJ7 4.69e-23 99 32 10 234 3 htpX Protease HtpX Yersinia pestis
B2K6A2 4.69e-23 99 32 10 234 3 htpX Protease HtpX Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C6Z1 4.69e-23 99 32 10 234 3 htpX Protease HtpX Yersinia pestis bv. Antiqua (strain Antiqua)
A7FHC3 4.69e-23 99 32 10 234 3 htpX Protease HtpX Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A5V7N3 4.9e-23 100 33 6 217 3 htpX Protease HtpX homolog Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q083Z6 5.18e-23 99 31 7 231 3 htpX Protease HtpX Shewanella frigidimarina (strain NCIMB 400)
B4ETJ0 5.94e-23 99 29 7 228 3 htpX Protease HtpX Proteus mirabilis (strain HI4320)
Q07T82 6.18e-23 99 30 9 263 3 htpX Protease HtpX homolog Rhodopseudomonas palustris (strain BisA53)
Q7MLU5 6.45e-23 99 31 11 262 3 htpX Protease HtpX Vibrio vulnificus (strain YJ016)
B0KUP8 6.99e-23 99 31 7 225 3 htpX Protease HtpX Pseudomonas putida (strain GB-1)
B6EKC3 7.76e-23 99 32 9 233 3 htpX Protease HtpX Aliivibrio salmonicida (strain LFI1238)
A6UED6 9.02e-23 99 33 8 223 3 htpX Protease HtpX homolog Sinorhizobium medicae (strain WSM419)
A9L578 9.23e-23 99 31 7 229 3 htpX Protease HtpX Shewanella baltica (strain OS195)
A3D5N7 9.23e-23 99 31 7 229 3 htpX Protease HtpX Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E719 9.23e-23 99 31 7 229 3 htpX Protease HtpX Shewanella baltica (strain OS223)
Q12EQ7 1.02e-22 99 30 8 230 3 htpX Protease HtpX homolog Polaromonas sp. (strain JS666 / ATCC BAA-500)
B1J4W3 1.04e-22 99 31 7 225 3 htpX Protease HtpX Pseudomonas putida (strain W619)
Q2RNC2 1.07e-22 99 31 6 233 3 htpX Protease HtpX homolog Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
A1WH77 1.24e-22 98 31 8 221 3 htpX Protease HtpX homolog Verminephrobacter eiseniae (strain EF01-2)
Q3K933 1.24e-22 99 31 7 223 3 htpX Protease HtpX Pseudomonas fluorescens (strain Pf0-1)
Q3MH22 1.27e-22 98 29 8 265 3 htpX Protease HtpX homolog Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q5YPB8 1.27e-22 98 29 8 285 3 htpX Protease HtpX homolog Nocardia farcinica (strain IFM 10152)
Q4K8U3 1.36e-22 98 30 8 236 3 htpX Protease HtpX Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A8GDN1 1.62e-22 98 30 7 228 3 htpX Protease HtpX Serratia proteamaculans (strain 568)
Q1ID18 1.67e-22 98 31 7 225 3 htpX Protease HtpX Pseudomonas entomophila (strain L48)
Q5E5P9 1.69e-22 98 30 10 265 3 htpX Protease HtpX Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q8YUS1 1.92e-22 98 29 8 265 3 htpX Protease HtpX homolog Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P23894 2.16e-22 98 30 8 232 1 htpX Protease HtpX Escherichia coli (strain K12)
B1XH97 2.16e-22 98 30 8 232 3 htpX Protease HtpX Escherichia coli (strain K12 / DH10B)
C4ZZI6 2.16e-22 98 30 8 232 3 htpX Protease HtpX Escherichia coli (strain K12 / MC4100 / BW2952)
C3K733 2.4e-22 97 31 8 228 3 htpX Protease HtpX Pseudomonas fluorescens (strain SBW25)
A2SCF8 2.88e-22 97 29 8 235 3 htpX Protease HtpX homolog Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B5FDN8 3.14e-22 97 30 10 265 3 htpX Protease HtpX Aliivibrio fischeri (strain MJ11)
Q3SFQ0 3.27e-22 97 29 10 276 3 htpX Protease HtpX homolog Thiobacillus denitrificans (strain ATCC 25259)
Q88LQ8 3.6e-22 97 30 7 225 3 htpX Protease HtpX Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0C9E9 4.26e-22 97 31 7 241 3 htpX Protease HtpX homolog Acaryochloris marina (strain MBIC 11017)
Q59076 4.81e-22 97 29 8 300 3 htpX Protease HtpX homolog Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A5W758 5.39e-22 97 30 7 225 3 htpX Protease HtpX Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B0TJN4 5.6e-22 96 32 7 228 3 htpX Protease HtpX Shewanella halifaxensis (strain HAW-EB4)
A7HSR4 5.6e-22 96 30 10 252 3 htpX Protease HtpX homolog Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
B7VH11 6.78e-22 96 31 7 225 3 htpX Protease HtpX Vibrio atlanticus (strain LGP32)
A3QDP2 9.57e-22 96 30 7 228 3 htpX Protease HtpX Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B8H051 1.01e-21 96 28 7 260 3 htpX Protease HtpX homolog Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5E1 1.01e-21 96 28 7 260 3 htpX Protease HtpX homolog Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B8D7L3 1.12e-21 96 28 9 241 3 htpX Protease HtpX Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57406 1.12e-21 96 28 9 241 3 htpX Protease HtpX Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9B1 1.12e-21 96 28 9 241 3 htpX Protease HtpX Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B2JJU6 1.29e-21 95 30 8 236 3 htpX Protease HtpX homolog Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q7N3N4 1.58e-21 95 27 7 226 3 htpX Protease HtpX Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1XSN0 1.91e-21 95 30 7 225 3 htpX Protease HtpX homolog Polynucleobacter necessarius subsp. necessarius (strain STIR1)
B8HDM6 2.28e-21 95 28 7 273 3 htpX Protease HtpX homolog Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
Q63YR4 2.29e-21 95 29 6 233 3 htpX Protease HtpX homolog Burkholderia pseudomallei (strain K96243)
A3N4D7 2.29e-21 95 29 6 233 3 htpX Protease HtpX homolog Burkholderia pseudomallei (strain 668)
Q3JXD9 2.29e-21 95 29 6 233 3 htpX Protease HtpX homolog Burkholderia pseudomallei (strain 1710b)
A3NQ26 2.29e-21 95 29 6 233 3 htpX Protease HtpX homolog Burkholderia pseudomallei (strain 1106a)
A1V794 2.29e-21 95 29 6 233 3 htpX Protease HtpX homolog Burkholderia mallei (strain SAVP1)
Q62MT2 2.29e-21 95 29 6 233 3 htpX Protease HtpX homolog Burkholderia mallei (strain ATCC 23344)
A2S8H2 2.29e-21 95 29 6 233 3 htpX Protease HtpX homolog Burkholderia mallei (strain NCTC 10229)
A3MNP7 2.29e-21 95 29 6 233 3 htpX Protease HtpX homolog Burkholderia mallei (strain NCTC 10247)
A1R944 2.4e-21 95 29 7 273 3 htpX Protease HtpX homolog Paenarthrobacter aurescens (strain TC1)
A6WPJ1 2.49e-21 95 31 7 229 3 htpX Protease HtpX Shewanella baltica (strain OS185)
Q3A7Y9 3.33e-21 94 31 5 217 3 htpX Protease HtpX homolog Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A7MX22 4.14e-21 94 31 11 251 3 htpX Protease HtpX Vibrio campbellii (strain ATCC BAA-1116)
A8FX04 4.17e-21 94 31 7 229 3 htpX Protease HtpX Shewanella sediminis (strain HAW-EB3)
A8H3J1 4.7e-21 94 32 7 228 3 htpX Protease HtpX Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q2T2A9 6.04e-21 94 29 6 233 3 htpX Protease HtpX homolog Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A3PLU3 8.72e-21 94 32 8 225 3 htpX Protease HtpX homolog Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q3J0F7 9.17e-21 93 32 8 225 3 htpX Protease HtpX homolog Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
B2T1K8 9.49e-21 93 29 6 233 3 htpX Protease HtpX homolog Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
B2J204 1.02e-20 93 28 8 266 3 htpX Protease HtpX homolog Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
A5D0V1 1.03e-20 93 28 7 259 3 htpX Protease HtpX homolog Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q5JEZ8 1.11e-20 93 28 7 260 3 htpX Protease HtpX homolog Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
C3LU14 1.15e-20 93 30 7 227 3 htpX Protease HtpX Vibrio cholerae serotype O1 (strain M66-2)
Q9KSY9 1.15e-20 93 30 7 227 3 htpX Protease HtpX Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F2H8 1.15e-20 93 30 7 227 3 htpX Protease HtpX Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C5A5K3 1.16e-20 93 28 8 260 3 htpX Protease HtpX homolog Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
A4WRW9 1.22e-20 93 29 10 279 3 htpX Protease HtpX homolog Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
B2U793 1.29e-20 93 29 6 233 3 htpX Protease HtpX homolog Ralstonia pickettii (strain 12J)
Q87QN1 1.33e-20 93 31 12 263 1 htpX Protease HtpX Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A5GAQ7 1.51e-20 92 29 5 232 3 htpX Protease HtpX homolog Geotalea uraniireducens (strain Rf4)
A6W5R0 1.96e-20 92 30 8 281 3 htpX Protease HtpX homolog Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Q1LTF8 2.31e-20 92 28 9 231 3 htpX Protease HtpX Baumannia cicadellinicola subsp. Homalodisca coagulata
A4JJ20 2.62e-20 92 29 6 233 3 htpX Protease HtpX homolog Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q2S6C2 3.21e-20 91 30 9 236 3 htpX Protease HtpX homolog Salinibacter ruber (strain DSM 13855 / M31)
Q39BU7 5.34e-20 91 29 6 233 3 htpX Protease HtpX homolog Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q83IG0 6.28e-20 91 29 6 251 3 htpX Protease HtpX homolog Tropheryma whipplei (strain TW08/27)
C0QPE1 6.5e-20 91 32 8 217 3 htpX Protease HtpX homolog Persephonella marina (strain DSM 14350 / EX-H1)
B4E7W0 7.65e-20 90 29 6 233 3 htpX Protease HtpX homolog Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q1BSJ6 7.81e-20 90 29 6 233 3 htpX Protease HtpX homolog Burkholderia orbicola (strain AU 1054)
B1K0J3 7.81e-20 90 29 6 233 3 htpX Protease HtpX homolog Burkholderia orbicola (strain MC0-3)
A0KBJ5 7.81e-20 90 29 6 233 3 htpX Protease HtpX homolog Burkholderia cenocepacia (strain HI2424)
A7I0F9 7.91e-20 90 33 6 220 3 htpX Protease HtpX homolog Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q0BAT8 7.96e-20 90 29 6 233 3 htpX Protease HtpX homolog Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YPX4 7.96e-20 90 29 6 233 3 htpX Protease HtpX homolog Burkholderia ambifaria (strain MC40-6)
Q8Y3A6 9.78e-20 90 29 6 236 3 htpX Protease HtpX homolog Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q83H47 1.02e-19 90 27 5 251 3 htpX Protease HtpX homolog Tropheryma whipplei (strain Twist)
A9AC67 1.56e-19 90 27 5 230 3 htpX Protease HtpX homolog Burkholderia multivorans (strain ATCC 17616 / 249)
Q31F55 2.07e-19 90 29 7 224 3 htpX Protease HtpX Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
P59559 3.86e-19 89 30 9 233 3 htpX Protease HtpX Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B8CQX8 4.35e-19 89 31 7 228 3 htpX Protease HtpX Shewanella piezotolerans (strain WP3 / JCM 13877)
B0T658 2.13e-18 87 29 9 272 3 htpX Protease HtpX homolog Caulobacter sp. (strain K31)
A5FUZ5 2.43e-18 86 33 7 235 3 htpX Protease HtpX homolog Acidiphilium cryptum (strain JF-5)
Q8PSE5 4.49e-18 86 31 9 279 3 htpX2 Protease HtpX homolog 2 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8R664 5.81e-18 86 29 7 235 3 htpX Protease HtpX homolog Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
B2V995 1.12e-17 85 27 6 262 3 htpX Protease HtpX homolog Sulfurihydrogenibium sp. (strain YO3AOP1)
Q8PXI2 1.89e-17 84 29 7 259 3 htpX1 Protease HtpX homolog 1 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
C1ABH4 3.14e-17 83 27 4 217 3 htpX Protease HtpX homolog Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
B2GI45 4.58e-16 80 28 5 260 3 htpX Protease HtpX homolog Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
A0JZI3 5.85e-16 80 32 6 245 3 htpX Protease HtpX homolog Arthrobacter sp. (strain FB24)
Q8TP15 1.14e-15 79 29 10 275 3 htpX2 Protease HtpX homolog 2 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
O67798 6.42e-15 77 31 6 259 3 htpX Protease HtpX homolog Aquifex aeolicus (strain VF5)
B1XWS3 2.8e-14 75 27 8 229 3 htpX Protease HtpX homolog Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
O26669 7.59e-14 73 29 4 189 3 htpX Protease HtpX homolog Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q9RKN3 8.79e-14 73 28 7 245 3 htpX1 Protease HtpX homolog 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q6L2Q7 2.04e-13 73 29 11 254 3 htpX Protease HtpX homolog Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
Q8TYX0 2.53e-13 72 26 9 279 3 htpX Protease HtpX homolog Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q97X95 5.21e-13 72 26 4 217 3 htpX1 Protease HtpX homolog 1 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
A3MVF0 6.63e-13 72 28 7 244 3 htpX Protease HtpX homolog Pyrobaculum calidifontis (strain DSM 21063 / JCM 11548 / VA1)
Q9HJV2 6.74e-13 71 28 6 212 3 htpX Protease HtpX homolog Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q8ZT30 1.59e-12 70 28 7 243 3 htpX Protease HtpX homolog Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
Q9YD67 2.01e-12 70 27 6 251 3 htpX Protease HtpX homolog Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
O30004 3.81e-11 66 26 8 225 3 htpX Protease HtpX homolog Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q97TZ9 4.02e-11 66 27 5 250 3 htpX2 Protease HtpX homolog 2 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q973R2 5.48e-11 65 28 3 153 3 htpX1 Protease HtpX homolog 1 Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q4JAE2 1.09e-10 65 28 6 212 3 htpX1 Protease HtpX homolog 1 Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q979X0 4.34e-10 63 26 9 300 3 htpX Protease HtpX homolog Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
C3NMG3 1.47e-09 62 28 5 199 3 htpX Protease HtpX homolog Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2)
Q96Y22 3.01e-09 60 26 6 248 3 htpX2 Protease HtpX homolog 2 Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q9HSQ2 9.09e-09 59 28 12 274 3 htpX Protease HtpX homolog Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q4JBJ9 8.28e-08 56 29 6 167 3 htpX2 Protease HtpX homolog 2 Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
A1RT82 2.1e-07 55 26 6 224 3 htpX Protease HtpX homolog Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3)
Q9LSC4 0.000124 47 28 9 202 1 PGM48 Plastoglobule-localized metallopeptidase 48, chloroplastic Arabidopsis thaliana

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00805
Feature type CDS
Gene htpX
Product zinc metalloprotease HtpX
Location 203036 - 204001 (strand: -1)
Length 966 (nucleotides) / 321 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_337
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF01435 Peptidase family M48

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0501 Posttranslational modification, protein turnover, chaperones (O) O Zn-dependent protease with chaperone function

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03799 heat shock protein HtpX [EC:3.4.24.-] - -

Protein Sequence

MDFRNVLRKNAIRTRFVIVTYLLLMLMIGLLVDSAIGANPHLSLIDNMLAFLTFQSLPIASLIIVAISIVLLIIVHFKGHKIMLTGMKARLINPEEPLNAQERQLLNIVEELSLSATLGYIPKLYILDTPEANAFAAGWSEKNAFIGVTRGLLNQLNRQEIQAVLAHETGHIIHGDTRLTLYVGILANVILTVTNIFGSRLYIASGNRGGKSNDAASKARLILIVLNVVLPIITQVLYFYLSRTREYMADAAAVDLTQDNQSMINALKKIAAQHETENFEDGSTGRAYRKAAFIFNKGDSLFSTHPSIENRIAVLEGKKTF

Flanking regions ( +/- flanking 50bp)

CCATAGCTTATACATAAAATAATACGGTAGATATTATTGGAGAATAATAAATGGATTTCAGAAATGTACTGCGAAAAAATGCCATTCGCACTCGGTTTGTGATAGTCACCTATTTACTATTAATGCTAATGATCGGCTTATTAGTTGATAGCGCGATAGGTGCCAATCCTCATTTAAGTTTAATTGATAATATGCTGGCATTTCTGACATTCCAATCACTGCCTATTGCTTCATTGATTATTGTTGCCATTTCAATTGTGTTGCTGATTATTGTTCACTTTAAAGGGCATAAAATCATGTTGACGGGCATGAAAGCGCGACTAATTAATCCTGAAGAGCCATTAAATGCCCAAGAGCGACAATTATTAAATATTGTGGAAGAGCTTAGTTTAAGTGCGACTTTGGGCTATATCCCTAAGCTTTATATTTTAGATACACCAGAAGCCAATGCCTTTGCTGCCGGCTGGTCTGAAAAAAATGCCTTTATTGGTGTCACTCGTGGGTTGTTAAATCAACTTAATCGCCAAGAAATACAAGCCGTATTAGCCCATGAAACAGGTCATATTATTCATGGTGATACCCGTTTAACGCTGTATGTGGGTATTTTAGCAAATGTTATTTTAACGGTAACAAATATCTTTGGTAGCCGCTTATATATAGCCTCTGGTAACCGTGGTGGTAAAAGTAATGATGCCGCCAGTAAAGCACGATTGATTTTAATTGTACTCAACGTTGTTTTACCCATTATTACTCAAGTGCTCTATTTCTATTTATCGCGGACACGTGAATATATGGCAGATGCGGCAGCGGTTGATCTCACCCAAGATAATCAATCAATGATCAATGCACTAAAGAAAATTGCAGCACAACACGAAACTGAAAATTTTGAAGATGGCTCTACAGGACGAGCATATCGCAAAGCAGCCTTTATTTTTAATAAGGGAGACTCTCTTTTTTCAACCCATCCTTCGATTGAAAATAGAATAGCAGTACTCGAAGGGAAAAAGACTTTTTAAACCAACAGATTAAAACAAAGCGTTTATCCATTATTATGGAATAAATACAT