Homologs in group_2163

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15980 FBDBKF_15980 70.1 Morganella morganii S1 dsrE Sulfur relay (sulfurtransferase) complex TusBCD TusD component, DsrE family
EHELCC_18585 EHELCC_18585 70.1 Morganella morganii S2 dsrE Sulfur relay (sulfurtransferase) complex TusBCD TusD component, DsrE family
NLDBIP_17415 NLDBIP_17415 70.1 Morganella morganii S4 dsrE Sulfur relay (sulfurtransferase) complex TusBCD TusD component, DsrE family
LHKJJB_17245 LHKJJB_17245 70.1 Morganella morganii S3 dsrE Sulfur relay (sulfurtransferase) complex TusBCD TusD component, DsrE family
HKOGLL_17150 HKOGLL_17150 70.1 Morganella morganii S5 dsrE Sulfur relay (sulfurtransferase) complex TusBCD TusD component, DsrE family
F4V73_RS16330 F4V73_RS16330 69.2 Morganella psychrotolerans - DsrE/DsrF/TusD sulfur relay family protein

Distribution of the homologs in the orthogroup group_2163

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2163

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AB54 2.21e-60 183 71 0 117 3 ychN Protein YchN Shigella flexneri
P0AB52 2.21e-60 183 71 0 117 1 ychN Protein YchN Escherichia coli (strain K12)
P0AB53 2.21e-60 183 71 0 117 3 ychN Protein YchN Escherichia coli O157:H7
P94948 4.56e-17 73 34 1 114 4 MK0008 Uncharacterized protein MK0008 Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q58396 2.64e-15 69 34 1 115 4 MJ0989 Uncharacterized protein MJ0989 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P44762 9.21e-05 42 24 5 126 3 tusD Sulfurtransferase TusD homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00650
Feature type CDS
Gene -
Product DsrE/DsrF/TusD sulfur relay family protein
Location 167039 - 167392 (strand: 1)
Length 354 (nucleotides) / 117 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2163
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02635 DsrE/DsrF-like family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1553 Inorganic ion transport and metabolism (P) P Sulfur relay (sulfurtransferase) complex TusBCD TusD component, DsrE family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06039 uncharacterized protein involved in oxidation of intracellular sulfur - -

Protein Sequence

MSKVLVIANGAAYGNESLFNALRLSITLKEQHPETQLNIFLMSDAVTGALAHQQPKEGYNLQQMLEILTAQNVPVKLCKTCTDTRGISELPLVDGAELGTLVDLAQWTLDADKILTF

Flanking regions ( +/- flanking 50bp)

GAGAATATCGGCGCTATCTTAATTTATTCTTAAACATAAGGAAGAAGTTCATGAGCAAAGTATTAGTGATTGCAAATGGTGCAGCATACGGTAATGAATCATTATTTAACGCACTGCGTTTATCTATTACTTTAAAAGAGCAACATCCAGAAACGCAATTAAATATCTTTTTAATGTCTGATGCGGTAACCGGTGCACTGGCTCATCAGCAACCCAAAGAAGGTTACAACCTCCAACAAATGTTAGAAATTTTAACGGCACAAAACGTCCCTGTTAAGTTATGCAAAACCTGTACAGATACTCGTGGTATCAGTGAATTACCTTTAGTGGATGGTGCTGAACTTGGGACATTGGTGGACTTAGCACAATGGACTCTCGACGCGGATAAGATTTTGACTTTCTGATCAATATTCTGTTTTCTCAGGGGAGAAACATCTAGGCGACTTGTTCTAAT