Homologs in group_4286
0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product |
|---|
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| Q57120 | 4.63e-22 | 84 | 53 | 0 | 63 | 3 | vapB2 | Antitoxin VapB2 | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Q4QLV9 | 4.63e-22 | 84 | 53 | 0 | 63 | 1 | vapB2 | Antitoxin VapB2 | Haemophilus influenzae (strain 86-028NP) |
| Q7CPV2 | 1.92e-16 | 69 | 48 | 1 | 75 | 1 | vapB | Antitoxin VapB | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
| O06663 | 3.29e-13 | 61 | 45 | 1 | 72 | 1 | vapB | Antitoxin VapB | Shigella flexneri |
| P18355 | 4.32e-13 | 61 | 45 | 1 | 72 | 3 | None | Uncharacterized protein in traD-traI intergenic region | Escherichia coli (strain K12) |
| Q4UNB3 | 1.13e-07 | 47 | 38 | 2 | 77 | 1 | vapB2 | Antitoxin VapB2 | Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) |
| Q46558 | 0.000348 | 38 | 31 | 1 | 77 | 3 | vapB | Virulence-associated protein B | Dichelobacter nodosus |
| Source | Proteus mirabilis HI4320 |
|---|---|
| Locus tag | PMI_RS00415 |
| Feature type | CDS |
| Gene | vapB |
| Product | type II toxin-antitoxin system VapB family antitoxin |
| Location | 114037 - 114279 (strand: -1) |
| Length | 243 (nucleotides) / 80 (amino acids) |
| Accession | NC_010554 |
|---|---|
| Length | 4063606 nucleotides |
| Topology | circular |
| Plasmid | False |
| Orthogroup | group_4286 | |
|---|---|---|
| Orthogroup size | 1 | |
| N. genomes | 1 |
MIQYGKVFMSNRTQNVRLPAETRFPDDVKEVFVRVKGKERIITPIQNAWDSFFLSEKSVTDDFLSERPDQATSERGSFDD
TGGTATCCTATAAAAACTGCTATATGGCAGTTTTTATAGGAGCTATTACTATGATCCAGTATGGCAAAGTATTTATGAGCAATAGAACACAAAATGTTCGATTACCCGCTGAGACTCGATTTCCGGATGATGTAAAAGAAGTTTTTGTTCGCGTCAAAGGCAAAGAGAGAATAATCACACCTATACAAAATGCATGGGATAGCTTTTTCTTATCAGAAAAGTCTGTAACAGATGATTTCTTATCTGAAAGGCCTGATCAAGCCACAAGTGAAAGAGGATCCTTTGATGATTAAATACCTATTAGATACAAATTATTGTTATATTCACTATTAAACGCAAGCCT
