Homologs in group_3806
1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product | |
|---|---|---|---|---|---|
| F4V73_RS00965 | F4V73_RS00965 | 64.9 | Morganella psychrotolerans | - | helix-turn-helix transcriptional regulator |
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|
| Source | Proteus mirabilis HI4320 |
|---|---|
| Locus tag | PMI_RS00270 |
| Feature type | CDS |
| Gene | - |
| Product | helix-turn-helix transcriptional regulator |
| Location | 84120 - 84413 (strand: -1) |
| Length | 294 (nucleotides) / 97 (amino acids) |
| Accession | NC_010554 |
|---|---|
| Length | 4063606 nucleotides |
| Topology | circular |
| Plasmid | False |
| Orthogroup | group_3806 | |
|---|---|---|
| Orthogroup size | 2 | |
| N. genomes | 2 |
| ID | Function(s) descr. | Function(s) cat. | Description |
|---|---|---|---|
| COG1813 | Translation, ribosomal structure and biogenesis (J) | J | Archaeal ribosome-binding protein aMBF1, putative translation factor, contains Zn-ribbon and HTH domains |
MKLSLLTDIDVSRAFATHLRKRREKEKWSREHLAERSTVPASTIKKFELQGKISLRQLLLLWQCLDDLNNLYAVVDPKKANKPRIPRTIEEVLQDEF
TCATGCTATAATTGGACATTATAGTATCCATTTTATGTTTAGAGCTAATAATGAAACTCTCATTACTTACCGATATTGATGTTAGTCGAGCTTTTGCTACTCATTTACGAAAACGACGAGAAAAAGAAAAATGGTCTCGGGAACATCTTGCCGAGCGCAGTACCGTCCCTGCATCAACAATTAAAAAATTTGAGTTACAAGGCAAAATTTCATTACGACAACTACTGTTACTTTGGCAGTGTCTTGATGATTTAAATAACCTTTATGCCGTTGTTGACCCTAAAAAAGCCAATAAGCCTCGTATACCAAGAACCATTGAAGAGGTATTACAAGATGAATTTTAAGCCAATAAAAAAATTAAATGTAACCCGGACGTTGTCTACAGGTGTTCAAG
