Homologs in group_3621

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20310 FBDBKF_20310 100.0 Morganella morganii S1 - IS3 family transposase
EHELCC_19060 EHELCC_19060 100.0 Morganella morganii S2 - IS3 family transposase
LHKJJB_19530 LHKJJB_19530 100.0 Morganella morganii S3 - IS3 family transposase
HKOGLL_19415 HKOGLL_19415 100.0 Morganella morganii S5 - IS3 family transposase

Distribution of the homologs in the orthogroup group_3621

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3621

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P35878 3.95e-16 76 33 3 160 3 nisX1 Transposase for insertion sequence element IS904 Lactococcus lactis subsp. lactis (strain IL1403)
P19769 1.12e-14 73 27 3 178 2 insK Putative transposase InsK for insertion sequence element IS150 Escherichia coli (strain K12)
P0CF85 1.65e-14 72 28 3 183 3 insF Transposase InsF for insertion sequence IS3 Escherichia coli O111:H-
P0CF84 1.65e-14 72 28 3 183 3 insF6 Transposase InsF for insertion sequence IS3fA Escherichia coli (strain K12)
P0CF83 1.65e-14 72 28 3 183 3 insF5 Transposase InsF for insertion sequence IS3E Escherichia coli (strain K12)
P0CF82 1.65e-14 72 28 3 183 3 insF4 Transposase InsF for insertion sequence IS3D Escherichia coli (strain K12)
P0CF81 1.65e-14 72 28 3 183 3 insF3 Transposase InsF for insertion sequence IS3C Escherichia coli (strain K12)
P0CF80 1.65e-14 72 28 3 183 3 insF2 Transposase InsF for insertion sequence IS3B Escherichia coli (strain K12)
P0CF79 1.65e-14 72 28 3 183 3 insF1 Transposase InsF for insertion sequence IS3A Escherichia coli (strain K12)
P16942 1.85e-14 72 31 4 163 4 None Transposase for insertion sequence element IS629 Shigella sonnei
P9WKH9 1.9e-14 72 28 3 166 4 Rv0796 Putative transposase for insertion sequence element IS986/IS6110 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A5TY79 1.9e-14 72 28 3 166 3 MRA_0011 Putative transposase for insertion sequence element IS986/IS6110 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P59800 1.9e-14 72 28 3 166 3 BQ2027_MB2838C Putative transposase for insertion sequence element IS986/IS6110 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WKH8 2.21e-14 72 27 2 166 3 MT1803 Putative transposase for insertion sequence element IS986/IS6110 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9JMT3 8.68e-14 70 36 1 115 3 insF7 Transposase InsF for insertion sequence IS3fB Escherichia coli (strain K12)
O05086 9.7e-12 64 27 1 130 3 HI_1721 Uncharacterized transposase-like protein HI_1721 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P16940 9.49e-11 62 28 2 127 4 None Insertion element IS600 uncharacterized 31 kDa protein Shigella sonnei
Q47718 5.02e-10 59 31 3 116 5 insO2 Putative transposase InsO for insertion sequence element IS911B Escherichia coli (strain K12)
P11257 3.65e-07 52 30 3 112 4 None Transposase for insertion sequence element IS3411 Escherichia coli
Q79CE8 5.48e-07 52 26 1 123 3 None Probable transposase for insertion sequence element IS1353 Shigella flexneri
P25059 8.57e-06 48 35 4 95 1 pol Gag-Pro-Pol polyprotein Bovine leukemia virus (isolate Australian)
P03361 1.38e-05 48 34 4 95 3 pol Gag-Pro-Pol polyprotein Bovine leukemia virus (isolate Japanese BLV-1)
P24577 5.09e-05 45 24 4 164 4 Bmul_4719 Insertion element IS407 uncharacterized 31.7 kDa protein Burkholderia multivorans (strain ATCC 17616 / 249)
P31623 0.000135 45 27 3 118 3 pol Gag-Pro-Pol polyprotein Sheep pulmonary adenomatosis virus
P25438 0.000159 44 28 1 110 4 None Insertion element IS476 uncharacterized 39.2 kDa protein Xanthomonas euvesicatoria
P12894 0.000468 43 28 4 119 3 None Intracisternal A-particle Pol-related polyprotein (Fragment) Mouse intracisternal a-particle IL3
P11368 0.000504 43 28 4 119 3 pol Intracisternal A-particle Pol-related polyprotein (Fragment) Mouse intracisternal a-particle MIA14

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_19535
Feature type CDS
Gene -
Product IS3 family transposase
Location 913 - 1452 (strand: -1)
Length 540 (nucleotides) / 179 (amino acids)
In genomic island -

Contig

Accession ZDB_550
Length 10442 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3621
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF00665 Integrase core domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2801 Mobilome: prophages, transposons (X) X Transposase InsO and inactivated derivatives

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07497 putative transposase - -

Protein Sequence

MRDLLNRQGHHIGRRHTRTLMKKMGIQALYCKPNLSQANQAHRKYPYLLKGLAIQRSNQVWSTDITYIPMAKGFVYLCAVIDWHSRKVLAHRVSISMEVDFCISALNEAIEKYGRPEIFNTDQGSQFTSDAFIDVLKSNGIQISMDGKGRWVDNVMVERLWRSVKYEEVYLKAYSSVTG

Flanking regions ( +/- flanking 50bp)

GATGTATTGATGAATTACATATGCAATATCCTTTTGCAGGCAGTCGTATGATGCGTGATTTGTTGAATCGTCAAGGACATCATATAGGACGACGTCATACACGTACTTTAATGAAGAAAATGGGTATTCAGGCGTTATATTGCAAACCAAATTTAAGCCAGGCTAATCAAGCTCACCGTAAATATCCATATCTGCTCAAAGGGTTGGCTATTCAGCGCAGTAATCAAGTGTGGTCTACGGATATAACGTATATCCCTATGGCAAAAGGCTTTGTTTATTTATGTGCTGTGATTGATTGGCATAGCCGCAAGGTACTTGCGCATAGGGTATCGATTAGTATGGAGGTGGATTTTTGTATTTCGGCTTTAAATGAAGCGATTGAAAAATATGGTCGACCTGAAATATTTAATACAGACCAAGGCAGCCAGTTTACCAGTGATGCATTTATTGATGTATTGAAATCAAATGGCATTCAAATCAGTATGGATGGTAAAGGTCGATGGGTAGATAATGTGATGGTTGAACGATTATGGCGGAGCGTTAAATATGAAGAGGTGTATCTCAAAGCTTATAGCAGTGTCACAGGGTGATGCTACCAACTTGCTGATTTAGTGTATAATGGTGTTTTTGAGGTGCTCCC