Homologs in group_2424

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19205 FBDBKF_19205 100.0 Morganella morganii S1 rpmC 50S ribosomal protein L29
EHELCC_18950 EHELCC_18950 100.0 Morganella morganii S2 rpmC 50S ribosomal protein L29
LHKJJB_18820 LHKJJB_18820 100.0 Morganella morganii S3 rpmC 50S ribosomal protein L29
HKOGLL_18555 HKOGLL_18555 100.0 Morganella morganii S5 rpmC 50S ribosomal protein L29
F4V73_RS18960 F4V73_RS18960 98.4 Morganella psychrotolerans rpmC 50S ribosomal protein L29
PMI_RS16190 PMI_RS16190 100.0 Proteus mirabilis HI4320 rpmC 50S ribosomal protein L29

Distribution of the homologs in the orthogroup group_2424

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2424

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F1J2 2.29e-37 121 100 0 63 3 rpmC Large ribosomal subunit protein uL29 Proteus mirabilis (strain HI4320)
P66170 1.02e-36 119 96 0 63 3 rpmC Large ribosomal subunit protein uL29 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66171 1.02e-36 119 96 0 63 3 rpmC Large ribosomal subunit protein uL29 Salmonella typhi
B4TXD4 1.02e-36 119 96 0 63 3 rpmC Large ribosomal subunit protein uL29 Salmonella schwarzengrund (strain CVM19633)
B5BGX8 1.02e-36 119 96 0 63 3 rpmC Large ribosomal subunit protein uL29 Salmonella paratyphi A (strain AKU_12601)
C0Q0A8 1.02e-36 119 96 0 63 3 rpmC Large ribosomal subunit protein uL29 Salmonella paratyphi C (strain RKS4594)
A9MSZ0 1.02e-36 119 96 0 63 3 rpmC Large ribosomal subunit protein uL29 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PIU1 1.02e-36 119 96 0 63 3 rpmC Large ribosomal subunit protein uL29 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUT2 1.02e-36 119 96 0 63 3 rpmC Large ribosomal subunit protein uL29 Salmonella newport (strain SL254)
B4TKK7 1.02e-36 119 96 0 63 3 rpmC Large ribosomal subunit protein uL29 Salmonella heidelberg (strain SL476)
B5RH23 1.02e-36 119 96 0 63 3 rpmC Large ribosomal subunit protein uL29 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R283 1.02e-36 119 96 0 63 3 rpmC Large ribosomal subunit protein uL29 Salmonella enteritidis PT4 (strain P125109)
B5FJK6 1.02e-36 119 96 0 63 3 rpmC Large ribosomal subunit protein uL29 Salmonella dublin (strain CT_02021853)
Q57J40 1.02e-36 119 96 0 63 3 rpmC Large ribosomal subunit protein uL29 Salmonella choleraesuis (strain SC-B67)
A9MN56 1.02e-36 119 96 0 63 3 rpmC Large ribosomal subunit protein uL29 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F7T7 1.02e-36 119 96 0 63 3 rpmC Large ribosomal subunit protein uL29 Salmonella agona (strain SL483)
A8AQK8 1.02e-36 119 96 0 63 3 rpmC Large ribosomal subunit protein uL29 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q7MYF9 5.51e-35 115 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C6DG66 6.25e-34 112 92 0 63 3 rpmC Large ribosomal subunit protein uL29 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6CZX8 3.35e-33 110 88 0 63 3 rpmC Large ribosomal subunit protein uL29 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q87T05 5e-32 107 84 0 63 3 rpmC Large ribosomal subunit protein uL29 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A1S226 5.88e-30 102 82 0 63 3 rpmC Large ribosomal subunit protein uL29 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A4SSZ8 3.52e-29 100 74 0 63 3 rpmC Large ribosomal subunit protein uL29 Aeromonas salmonicida (strain A449)
A1REC2 1.01e-28 99 80 0 63 3 rpmC Large ribosomal subunit protein uL29 Shewanella sp. (strain W3-18-1)
Q0I097 1.01e-28 99 80 0 63 3 rpmC Large ribosomal subunit protein uL29 Shewanella sp. (strain MR-7)
Q0HNS9 1.01e-28 99 80 0 63 3 rpmC Large ribosomal subunit protein uL29 Shewanella sp. (strain MR-4)
A0KRN2 1.01e-28 99 80 0 63 3 rpmC Large ribosomal subunit protein uL29 Shewanella sp. (strain ANA-3)
A4YBX5 1.01e-28 99 80 0 63 3 rpmC Large ribosomal subunit protein uL29 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EK61 1.01e-28 99 80 0 63 3 rpmC Large ribosomal subunit protein uL29 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q6LVA8 1.19e-28 99 79 0 63 3 rpmC Large ribosomal subunit protein uL29 Photobacterium profundum (strain SS9)
B0UX21 1.55e-28 99 79 0 63 3 rpmC Large ribosomal subunit protein uL29 Histophilus somni (strain 2336)
Q0I155 1.55e-28 99 79 0 63 3 rpmC Large ribosomal subunit protein uL29 Histophilus somni (strain 129Pt)
Q12SV1 2.51e-28 98 80 0 63 3 rpmC Large ribosomal subunit protein uL29 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q9CL39 3e-28 98 80 0 62 3 rpmC Large ribosomal subunit protein uL29 Pasteurella multocida (strain Pm70)
P55840 5.13e-28 97 79 0 62 3 rpmC Large ribosomal subunit protein uL29 Aggregatibacter actinomycetemcomitans
B8F763 5.85e-28 97 80 0 62 3 rpmC Large ribosomal subunit protein uL29 Glaesserella parasuis serovar 5 (strain SH0165)
B1KMX5 6.53e-28 97 79 0 63 3 rpmC Large ribosomal subunit protein uL29 Shewanella woodyi (strain ATCC 51908 / MS32)
A8G1E0 6.53e-28 97 79 0 63 3 rpmC Large ribosomal subunit protein uL29 Shewanella sediminis (strain HAW-EB3)
B8CNE1 6.53e-28 97 79 0 63 3 rpmC Large ribosomal subunit protein uL29 Shewanella piezotolerans (strain WP3 / JCM 13877)
B0TM04 6.53e-28 97 79 0 63 3 rpmC Large ribosomal subunit protein uL29 Shewanella halifaxensis (strain HAW-EB4)
B0BST9 1.56e-27 96 79 0 62 3 rpmC Large ribosomal subunit protein uL29 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZ19 1.56e-27 96 79 0 62 3 rpmC Large ribosomal subunit protein uL29 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N366 1.56e-27 96 79 0 62 3 rpmC Large ribosomal subunit protein uL29 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A9KWB0 1.96e-27 96 79 0 63 3 rpmC Large ribosomal subunit protein uL29 Shewanella baltica (strain OS195)
A6WHT6 1.96e-27 96 79 0 63 3 rpmC Large ribosomal subunit protein uL29 Shewanella baltica (strain OS185)
A3DA64 1.96e-27 96 79 0 63 3 rpmC Large ribosomal subunit protein uL29 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBJ7 1.96e-27 96 79 0 63 3 rpmC Large ribosomal subunit protein uL29 Shewanella baltica (strain OS223)
A3Q990 2.21e-27 96 77 0 63 3 rpmC Large ribosomal subunit protein uL29 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q65QW3 2.21e-27 96 79 0 62 3 rpmC Large ribosomal subunit protein uL29 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P44365 2.26e-27 96 77 0 62 3 rpmC Large ribosomal subunit protein uL29 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHT8 2.26e-27 96 77 0 62 3 rpmC Large ribosomal subunit protein uL29 Haemophilus influenzae (strain PittGG)
A5UDT9 2.26e-27 96 77 0 62 3 rpmC Large ribosomal subunit protein uL29 Haemophilus influenzae (strain PittEE)
Q4QMB4 2.26e-27 96 77 0 62 3 rpmC Large ribosomal subunit protein uL29 Haemophilus influenzae (strain 86-028NP)
Q3IFM4 3.74e-27 95 72 0 62 3 rpmC Large ribosomal subunit protein uL29 Pseudoalteromonas translucida (strain TAC 125)
A8GYY4 4.56e-27 95 77 0 63 3 rpmC Large ribosomal subunit protein uL29 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A1TYK5 7.56e-27 95 75 0 62 3 rpmC Large ribosomal subunit protein uL29 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q5QXX2 8.17e-27 94 73 0 63 3 rpmC Large ribosomal subunit protein uL29 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q089P6 8.72e-27 94 77 0 63 3 rpmC Large ribosomal subunit protein uL29 Shewanella frigidimarina (strain NCIMB 400)
A6VLJ6 8.92e-27 94 79 0 62 3 rpmC Large ribosomal subunit protein uL29 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A7MPH1 9.21e-27 94 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Cronobacter sakazakii (strain ATCC BAA-894)
C4L7T8 1.16e-26 94 73 0 63 3 rpmC Large ribosomal subunit protein uL29 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B1JIW9 1.24e-26 94 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664S9 1.24e-26 94 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TH00 1.24e-26 94 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Yersinia pestis (strain Pestoides F)
Q1CCV2 1.24e-26 94 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R904 1.24e-26 94 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJA4 1.24e-26 94 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Yersinia pestis
B2K5M2 1.24e-26 94 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2V5 1.24e-26 94 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNM7 1.24e-26 94 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q3YWU7 2.73e-26 93 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Shigella sonnei (strain Ss046)
Q0SZZ0 2.73e-26 93 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Shigella flexneri serotype 5b (strain 8401)
Q31VW4 2.73e-26 93 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Shigella boydii serotype 4 (strain Sb227)
B2U2T0 2.73e-26 93 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LRS8 2.73e-26 93 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R615 2.73e-26 93 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Escherichia coli (strain UTI89 / UPEC)
B1LHC6 2.73e-26 93 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Escherichia coli (strain SMS-3-5 / SECEC)
B6I226 2.73e-26 93 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Escherichia coli (strain SE11)
B7NDT3 2.73e-26 93 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7M6 2.73e-26 93 95 0 63 1 rpmC Large ribosomal subunit protein uL29 Escherichia coli (strain K12)
B1IPY7 2.73e-26 93 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7M7 2.73e-26 93 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCE9 2.73e-26 93 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A5B7 2.73e-26 93 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Escherichia coli O9:H4 (strain HS)
B1X6G4 2.73e-26 93 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Escherichia coli (strain K12 / DH10B)
C4ZUG7 2.73e-26 93 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1M6 2.73e-26 93 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Escherichia coli O8 (strain IAI1)
B7N196 2.73e-26 93 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Escherichia coli O81 (strain ED1a)
B7NLN1 2.73e-26 93 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YTN3 2.73e-26 93 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7M8 2.73e-26 93 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Escherichia coli O157:H7
B7L4J8 2.73e-26 93 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Escherichia coli (strain 55989 / EAEC)
B7MCS7 2.73e-26 93 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UK36 2.73e-26 93 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSK1 2.73e-26 93 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Escherichia coli O139:H28 (strain E24377A / ETEC)
A6TEW4 2.92e-26 93 92 0 63 3 rpmC Large ribosomal subunit protein uL29 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XNA2 2.92e-26 93 92 0 63 3 rpmC Large ribosomal subunit protein uL29 Klebsiella pneumoniae (strain 342)
Q83PY7 4.78e-26 92 93 0 63 3 rpmC Large ribosomal subunit protein uL29 Shigella flexneri
Q9HWE3 5e-26 92 74 0 62 1 rpmC Large ribosomal subunit protein uL29 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T72 5e-26 92 74 0 62 3 rpmC Large ribosomal subunit protein uL29 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V652 5e-26 92 74 0 62 3 rpmC Large ribosomal subunit protein uL29 Pseudomonas aeruginosa (strain LESB58)
A6UZJ6 5e-26 92 74 0 62 3 rpmC Large ribosomal subunit protein uL29 Pseudomonas aeruginosa (strain PA7)
A1JS26 5.52e-26 92 95 0 63 3 rpmC Large ribosomal subunit protein uL29 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GKI9 6.23e-26 92 95 0 62 3 rpmC Large ribosomal subunit protein uL29 Serratia proteamaculans (strain 568)
A4WFC0 8.38e-26 92 92 0 63 3 rpmC Large ribosomal subunit protein uL29 Enterobacter sp. (strain 638)
B4S099 1.01e-25 92 71 0 63 3 rpmC Large ribosomal subunit protein uL29 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q32B39 1.39e-25 91 93 0 63 3 rpmC Large ribosomal subunit protein uL29 Shigella dysenteriae serotype 1 (strain Sd197)
A1T0D4 2.68e-25 90 73 0 63 3 rpmC Large ribosomal subunit protein uL29 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q2NQN0 3.65e-25 90 92 0 63 3 rpmC Large ribosomal subunit protein uL29 Sodalis glossinidius (strain morsitans)
Q7VKD9 4.85e-25 90 74 0 62 3 rpmC Large ribosomal subunit protein uL29 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B2VK56 5.98e-25 90 90 0 63 3 rpmC Large ribosomal subunit protein uL29 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A6W384 6.6e-25 90 72 0 62 3 rpmC Large ribosomal subunit protein uL29 Marinomonas sp. (strain MWYL1)
C5BGL7 7.36e-25 89 93 0 63 3 rpmC Large ribosomal subunit protein uL29 Edwardsiella ictaluri (strain 93-146)
Q4ZMQ2 7.78e-25 89 70 0 62 3 rpmC Large ribosomal subunit protein uL29 Pseudomonas syringae pv. syringae (strain B728a)
Q889W3 7.78e-25 89 70 0 62 3 rpmC Large ribosomal subunit protein uL29 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3K5Z6 7.78e-25 89 70 0 62 3 rpmC Large ribosomal subunit protein uL29 Pseudomonas fluorescens (strain Pf0-1)
A5VXQ5 7.78e-25 89 70 0 62 3 rpmC Large ribosomal subunit protein uL29 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
C3K2W8 7.78e-25 89 70 0 62 3 rpmC Large ribosomal subunit protein uL29 Pseudomonas fluorescens (strain SBW25)
Q4K541 7.78e-25 89 70 0 62 3 rpmC Large ribosomal subunit protein uL29 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q48D44 7.78e-25 89 70 0 62 3 rpmC Large ribosomal subunit protein uL29 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B1JDX6 9.21e-25 89 70 0 62 3 rpmC Large ribosomal subunit protein uL29 Pseudomonas putida (strain W619)
Q88QM7 9.21e-25 89 70 0 62 3 rpmC Large ribosomal subunit protein uL29 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KK75 9.21e-25 89 70 0 62 3 rpmC Large ribosomal subunit protein uL29 Pseudomonas putida (strain GB-1)
Q1IFV8 9.21e-25 89 70 0 62 3 rpmC Large ribosomal subunit protein uL29 Pseudomonas entomophila (strain L48)
P46174 1.01e-24 89 91 0 62 3 rpmC Large ribosomal subunit protein uL29 Buchnera aphidicola subsp. Acyrthosiphon kondoi
C1DKM1 1.79e-24 89 69 0 62 3 rpmC Large ribosomal subunit protein uL29 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q1LTD0 3.74e-24 88 69 0 63 3 rpmC Large ribosomal subunit protein uL29 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q7MPI0 8.06e-24 87 85 0 63 3 rpmC Large ribosomal subunit protein uL29 Vibrio vulnificus (strain YJ016)
Q8DE47 8.06e-24 87 85 0 63 3 rpmC Large ribosomal subunit protein uL29 Vibrio vulnificus (strain CMCP6)
A7N0I5 8.06e-24 87 85 0 63 3 rpmC Large ribosomal subunit protein uL29 Vibrio campbellii (strain ATCC BAA-1116)
C3LRQ0 2.64e-23 85 84 0 63 3 rpmC Large ribosomal subunit protein uL29 Vibrio cholerae serotype O1 (strain M66-2)
Q9KNZ2 2.64e-23 85 84 0 63 3 rpmC Large ribosomal subunit protein uL29 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F558 2.64e-23 85 84 0 63 3 rpmC Large ribosomal subunit protein uL29 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q2S920 1.17e-22 84 67 0 62 3 rpmC Large ribosomal subunit protein uL29 Hahella chejuensis (strain KCTC 2396)
C4K7B0 3.69e-22 83 65 0 61 3 rpmC Large ribosomal subunit protein uL29 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A1KRI1 5.91e-21 80 63 0 61 3 rpmC Large ribosomal subunit protein uL29 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P66169 5.91e-21 80 63 0 61 3 rpmC Large ribosomal subunit protein uL29 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66168 5.91e-21 80 63 0 61 3 rpmC Large ribosomal subunit protein uL29 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M3V8 5.91e-21 80 63 0 61 3 rpmC Large ribosomal subunit protein uL29 Neisseria meningitidis serogroup C (strain 053442)
B4RQY5 5.91e-21 80 63 0 61 3 rpmC Large ribosomal subunit protein uL29 Neisseria gonorrhoeae (strain NCCP11945)
Q5F5T5 5.91e-21 80 63 0 61 3 rpmC Large ribosomal subunit protein uL29 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B6EPT3 1.36e-20 79 84 0 63 3 rpmC Large ribosomal subunit protein uL29 Aliivibrio salmonicida (strain LFI1238)
B5FG17 1.36e-20 79 84 0 63 3 rpmC Large ribosomal subunit protein uL29 Aliivibrio fischeri (strain MJ11)
Q5E8A7 1.36e-20 79 84 0 63 3 rpmC Large ribosomal subunit protein uL29 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q1R0G7 2.66e-20 78 77 0 62 3 rpmC Large ribosomal subunit protein uL29 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
C1DAS5 3.19e-20 78 64 0 62 3 rpmC Large ribosomal subunit protein uL29 Laribacter hongkongensis (strain HLHK9)
C5BQ69 4.88e-20 77 61 0 63 3 rpmC Large ribosomal subunit protein uL29 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q0VSJ5 8.23e-20 77 64 0 62 3 rpmC Large ribosomal subunit protein uL29 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q5WZK4 9.02e-20 77 60 0 61 3 rpmC Large ribosomal subunit protein uL29 Legionella pneumophila (strain Lens)
Q5ZYN5 9.02e-20 77 60 0 61 3 rpmC Large ribosomal subunit protein uL29 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHQ6 9.02e-20 77 60 0 61 3 rpmC Large ribosomal subunit protein uL29 Legionella pneumophila (strain Corby)
Q5X851 9.02e-20 77 60 0 61 3 rpmC Large ribosomal subunit protein uL29 Legionella pneumophila (strain Paris)
Q89A74 9.88e-20 77 61 0 60 3 rpmC Large ribosomal subunit protein uL29 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P57583 1.18e-19 77 67 0 56 3 rpmC Large ribosomal subunit protein uL29 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
A4VHN8 1.31e-19 76 74 0 62 3 rpmC Large ribosomal subunit protein uL29 Stutzerimonas stutzeri (strain A1501)
Q8K958 3.81e-19 75 66 0 56 3 rpmC Large ribosomal subunit protein uL29 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A4XZ82 4.09e-19 75 69 0 62 3 rpmC Large ribosomal subunit protein uL29 Pseudomonas mendocina (strain ymp)
B8D841 6.11e-19 75 67 0 55 3 rpmC Large ribosomal subunit protein uL29 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8D9T9 6.11e-19 75 67 0 55 3 rpmC Large ribosomal subunit protein uL29 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q0BYC2 8.49e-19 74 57 0 63 3 rpmC Large ribosomal subunit protein uL29 Hyphomonas neptunium (strain ATCC 15444)
Q1GK21 8.9e-19 74 58 0 63 3 rpmC Large ribosomal subunit protein uL29 Ruegeria sp. (strain TM1040)
Q605C0 6.25e-18 72 58 0 62 3 rpmC Large ribosomal subunit protein uL29 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q15YN1 1.02e-17 72 73 0 63 3 rpmC Large ribosomal subunit protein uL29 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q488A1 1.04e-17 72 74 0 62 3 rpmC Large ribosomal subunit protein uL29 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q7NQG0 2.19e-17 70 60 0 61 3 rpmC Large ribosomal subunit protein uL29 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
P66165 2.19e-17 71 54 0 62 3 rpmC Large ribosomal subunit protein uL29 Brucella suis biovar 1 (strain 1330)
B0CH24 2.19e-17 71 54 0 62 3 rpmC Large ribosomal subunit protein uL29 Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VQZ8 2.19e-17 71 54 0 62 3 rpmC Large ribosomal subunit protein uL29 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P66164 2.19e-17 71 54 0 62 3 rpmC Large ribosomal subunit protein uL29 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJJ3 2.19e-17 71 54 0 62 3 rpmC Large ribosomal subunit protein uL29 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5P2 2.19e-17 71 54 0 62 3 rpmC Large ribosomal subunit protein uL29 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57CR6 2.19e-17 71 54 0 62 3 rpmC Large ribosomal subunit protein uL29 Brucella abortus biovar 1 (strain 9-941)
Q2YRA3 2.19e-17 71 54 0 62 3 rpmC Large ribosomal subunit protein uL29 Brucella abortus (strain 2308)
B2S671 2.19e-17 71 54 0 62 3 rpmC Large ribosomal subunit protein uL29 Brucella abortus (strain S19)
Q7VTC5 4.14e-17 70 61 0 62 3 rpmC Large ribosomal subunit protein uL29 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2E8 4.14e-17 70 61 0 62 3 rpmC Large ribosomal subunit protein uL29 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRB7 4.14e-17 70 61 0 62 3 rpmC Large ribosomal subunit protein uL29 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A9IIY8 4.99e-17 70 61 0 62 3 rpmC Large ribosomal subunit protein uL29 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q11HR0 7.08e-17 69 49 0 63 3 rpmC Large ribosomal subunit protein uL29 Chelativorans sp. (strain BNC1)
B3R7R5 1.01e-16 69 60 0 63 3 rpmC Large ribosomal subunit protein uL29 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q46WF2 1.01e-16 69 60 0 63 3 rpmC Large ribosomal subunit protein uL29 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q1LI45 1.01e-16 69 60 0 63 3 rpmC Large ribosomal subunit protein uL29 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q8XV20 1.15e-16 69 60 0 61 3 rpmC Large ribosomal subunit protein uL29 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q1H4M9 1.31e-16 69 58 0 63 3 rpmC Large ribosomal subunit protein uL29 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q2L2B5 1.46e-16 68 59 0 62 3 rpmC Large ribosomal subunit protein uL29 Bordetella avium (strain 197N)
B6IRR4 1.8e-16 68 55 0 59 3 rpmC Large ribosomal subunit protein uL29 Rhodospirillum centenum (strain ATCC 51521 / SW)
Q0ABG7 3.21e-16 68 57 0 63 3 rpmC Large ribosomal subunit protein uL29 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q0K627 3.53e-16 68 58 0 63 3 rpmC Large ribosomal subunit protein uL29 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B2FQ53 4.36e-16 67 56 0 57 3 rpmC Large ribosomal subunit protein uL29 Stenotrophomonas maltophilia (strain K279a)
Q3J8S2 4.67e-16 67 61 0 60 3 rpmC Large ribosomal subunit protein uL29 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B2UEL1 5.18e-16 67 59 0 61 3 rpmC Large ribosomal subunit protein uL29 Ralstonia pickettii (strain 12J)
B4SKX1 7.63e-16 67 56 0 57 3 rpmC Large ribosomal subunit protein uL29 Stenotrophomonas maltophilia (strain R551-3)
Q6G2X3 9.12e-16 67 53 0 60 3 rpmC Large ribosomal subunit protein uL29 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A7HWR9 1.05e-15 67 53 0 56 3 rpmC Large ribosomal subunit protein uL29 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q6FZD0 2.05e-15 66 51 0 60 3 rpmC Large ribosomal subunit protein uL29 Bartonella quintana (strain Toulouse)
Q87E74 2.6e-15 65 51 0 58 3 rpmC Large ribosomal subunit protein uL29 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q13TH8 2.87e-15 65 58 0 62 3 rpmC Large ribosomal subunit protein uL29 Paraburkholderia xenovorans (strain LB400)
B2T743 2.87e-15 65 58 0 62 3 rpmC Large ribosomal subunit protein uL29 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A5EX91 2.87e-15 65 55 0 60 3 rpmC Large ribosomal subunit protein uL29 Dichelobacter nodosus (strain VCS1703A)
A9IW17 4.62e-15 65 50 0 60 3 rpmC Large ribosomal subunit protein uL29 Bartonella tribocorum (strain CIP 105476 / IBS 506)
A7IFY9 4.99e-15 65 53 0 60 3 rpmC Large ribosomal subunit protein uL29 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
B8H4E2 6.87e-15 64 46 0 63 3 rpmC Large ribosomal subunit protein uL29 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A8U5 6.87e-15 64 46 0 63 3 rpmC Large ribosomal subunit protein uL29 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B9JVP5 7.24e-15 64 51 0 62 3 rpmC Large ribosomal subunit protein uL29 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
A8LM65 1.47e-14 63 51 0 60 3 rpmC Large ribosomal subunit protein uL29 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q5GWU2 1.56e-14 63 56 0 57 3 rpmC Large ribosomal subunit protein uL29 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQR8 1.56e-14 63 56 0 57 3 rpmC Large ribosomal subunit protein uL29 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZZ3 1.56e-14 63 56 0 57 3 rpmC Large ribosomal subunit protein uL29 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BWX5 1.56e-14 63 56 0 57 3 rpmC Large ribosomal subunit protein uL29 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PC42 1.68e-14 63 56 0 57 3 rpmC Large ribosomal subunit protein uL29 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RU74 1.68e-14 63 56 0 57 3 rpmC Large ribosomal subunit protein uL29 Xanthomonas campestris pv. campestris (strain B100)
Q4URE7 1.68e-14 63 56 0 57 3 rpmC Large ribosomal subunit protein uL29 Xanthomonas campestris pv. campestris (strain 8004)
Q9PE68 1.96e-14 63 50 0 58 3 rpmC Large ribosomal subunit protein uL29 Xylella fastidiosa (strain 9a5c)
Q0BUP2 2.07e-14 63 52 0 59 3 rpmC Large ribosomal subunit protein uL29 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
B0V6X6 2.23e-14 63 58 0 62 3 rpmC Large ribosomal subunit protein uL29 Acinetobacter baumannii (strain AYE)
A3M976 2.23e-14 63 58 0 62 3 rpmC Large ribosomal subunit protein uL29 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VQS6 2.23e-14 63 58 0 62 3 rpmC Large ribosomal subunit protein uL29 Acinetobacter baumannii (strain SDF)
B2HZA0 2.23e-14 63 58 0 62 3 rpmC Large ribosomal subunit protein uL29 Acinetobacter baumannii (strain ACICU)
B7IA31 2.23e-14 63 58 0 62 1 rpmC Large ribosomal subunit protein uL29 Acinetobacter baumannii (strain AB0057)
B7GW10 2.23e-14 63 58 0 62 3 rpmC Large ribosomal subunit protein uL29 Acinetobacter baumannii (strain AB307-0294)
Q8UE26 2.26e-14 63 50 0 62 3 rpmC Large ribosomal subunit protein uL29 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q2SU35 2.33e-14 63 56 0 62 3 rpmC Large ribosomal subunit protein uL29 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63Q19 2.33e-14 63 56 0 62 3 rpmC Large ribosomal subunit protein uL29 Burkholderia pseudomallei (strain K96243)
A3NEH1 2.33e-14 63 56 0 62 3 rpmC Large ribosomal subunit protein uL29 Burkholderia pseudomallei (strain 668)
Q3JMS1 2.33e-14 63 56 0 62 3 rpmC Large ribosomal subunit protein uL29 Burkholderia pseudomallei (strain 1710b)
A3P0A5 2.33e-14 63 56 0 62 3 rpmC Large ribosomal subunit protein uL29 Burkholderia pseudomallei (strain 1106a)
A1V895 2.33e-14 63 56 0 62 3 rpmC Large ribosomal subunit protein uL29 Burkholderia mallei (strain SAVP1)
Q62GL3 2.33e-14 63 56 0 62 3 rpmC Large ribosomal subunit protein uL29 Burkholderia mallei (strain ATCC 23344)
A2S7I4 2.33e-14 63 56 0 62 3 rpmC Large ribosomal subunit protein uL29 Burkholderia mallei (strain NCTC 10229)
A3MRW2 2.33e-14 63 56 0 62 3 rpmC Large ribosomal subunit protein uL29 Burkholderia mallei (strain NCTC 10247)
A4JAP8 2.77e-14 63 54 0 62 3 rpmC Large ribosomal subunit protein uL29 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1BRV6 2.77e-14 63 54 0 62 3 rpmC Large ribosomal subunit protein uL29 Burkholderia orbicola (strain AU 1054)
B1JU30 2.77e-14 63 54 0 62 3 rpmC Large ribosomal subunit protein uL29 Burkholderia orbicola (strain MC0-3)
A9ADK1 2.77e-14 63 54 0 62 3 rpmC Large ribosomal subunit protein uL29 Burkholderia multivorans (strain ATCC 17616 / 249)
Q39KF9 2.77e-14 63 54 0 62 3 rpmC Large ribosomal subunit protein uL29 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BJ38 2.77e-14 63 54 0 62 3 rpmC Large ribosomal subunit protein uL29 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E5C8 2.77e-14 63 54 0 62 3 rpmC Large ribosomal subunit protein uL29 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K3N3 2.77e-14 63 54 0 62 3 rpmC Large ribosomal subunit protein uL29 Burkholderia cenocepacia (strain HI2424)
B1YRN7 2.77e-14 63 54 0 62 3 rpmC Large ribosomal subunit protein uL29 Burkholderia ambifaria (strain MC40-6)
B9JDT6 2.79e-14 63 50 0 62 3 rpmC Large ribosomal subunit protein uL29 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B1Y8H9 3.17e-14 63 53 0 60 3 rpmC Large ribosomal subunit protein uL29 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q1MID3 4.88e-14 62 48 0 62 3 rpmC Large ribosomal subunit protein uL29 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A6U867 4.93e-14 62 48 0 62 3 rpmC Large ribosomal subunit protein uL29 Sinorhizobium medicae (strain WSM419)
C3MAY8 4.93e-14 62 48 0 62 3 rpmC Large ribosomal subunit protein uL29 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B5ZYU3 7.39e-14 62 48 0 62 3 rpmC Large ribosomal subunit protein uL29 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q98N49 7.39e-14 62 48 0 56 3 rpmC Large ribosomal subunit protein uL29 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B3PWS9 7.48e-14 62 48 0 62 3 rpmC Large ribosomal subunit protein uL29 Rhizobium etli (strain CIAT 652)
Q8PNR7 7.64e-14 62 54 0 57 3 rpmC Large ribosomal subunit protein uL29 Xanthomonas axonopodis pv. citri (strain 306)
Q92QG2 8.72e-14 62 48 0 62 3 rpmC Large ribosomal subunit protein uL29 Rhizobium meliloti (strain 1021)
B4R8M5 1.01e-13 62 46 0 60 3 rpmC Large ribosomal subunit protein uL29 Phenylobacterium zucineum (strain HLK1)
Q16AD6 1.22e-13 61 47 0 63 3 rpmC Large ribosomal subunit protein uL29 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q2K9K8 1.4e-13 61 48 0 62 3 rpmC Large ribosomal subunit protein uL29 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q5LW50 1.54e-13 61 48 0 62 3 rpmC Large ribosomal subunit protein uL29 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q2LQB2 1.72e-13 61 52 0 61 3 rpmC Large ribosomal subunit protein uL29 Syntrophus aciditrophicus (strain SB)
A4WVK0 2.03e-13 61 46 0 63 3 rpmC Large ribosomal subunit protein uL29 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
B2A4E7 2.41e-13 60 55 0 60 3 rpmC Large ribosomal subunit protein uL29 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q28UU6 2.63e-13 60 50 0 57 3 rpmC Large ribosomal subunit protein uL29 Jannaschia sp. (strain CCS1)
Q97EI6 2.95e-13 60 54 0 59 3 rpmC Large ribosomal subunit protein uL29 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q6F7S0 3.82e-13 60 56 0 62 3 rpmC Large ribosomal subunit protein uL29 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q2N9B9 4.15e-13 60 48 0 62 3 rpmC Large ribosomal subunit protein uL29 Erythrobacter litoralis (strain HTCC2594)
Q1GPA7 5.16e-13 60 48 0 60 3 rpmC Large ribosomal subunit protein uL29 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q3SLP1 6.66e-13 59 53 0 62 3 rpmC Large ribosomal subunit protein uL29 Thiobacillus denitrificans (strain ATCC 25259)
Q2IXQ2 7.2e-13 59 43 0 60 3 rpmC Large ribosomal subunit protein uL29 Rhodopseudomonas palustris (strain HaA2)
A1WVB4 7.57e-13 59 60 0 63 3 rpmC Large ribosomal subunit protein uL29 Halorhodospira halophila (strain DSM 244 / SL1)
Q134T7 7.86e-13 59 43 0 60 3 rpmC Large ribosomal subunit protein uL29 Rhodopseudomonas palustris (strain BisB5)
A1KB19 1.48e-12 58 64 0 62 3 rpmC Large ribosomal subunit protein uL29 Azoarcus sp. (strain BH72)
A6T3J6 3.02e-12 58 53 0 60 3 rpmC Large ribosomal subunit protein uL29 Janthinobacterium sp. (strain Marseille)
A4G9T0 3.02e-12 58 53 0 60 3 rpmC Large ribosomal subunit protein uL29 Herminiimonas arsenicoxydans
C4ZBS7 3.04e-12 58 47 0 59 3 rpmC Large ribosomal subunit protein uL29 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
B0U0Y1 3.17e-12 58 43 0 57 3 rpmC Large ribosomal subunit protein uL29 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q1AU37 3.21e-12 58 55 0 60 3 rpmC Large ribosomal subunit protein uL29 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q8D204 3.4e-12 58 70 0 37 3 rpmC Large ribosomal subunit protein uL29 Wigglesworthia glossinidia brevipalpis
B8I7Y7 3.58e-12 58 53 0 60 3 rpmC Large ribosomal subunit protein uL29 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q1QN22 3.63e-12 58 39 0 63 3 rpmC Large ribosomal subunit protein uL29 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q82X81 3.97e-12 57 50 0 62 3 rpmC Large ribosomal subunit protein uL29 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A4IZS6 4.6e-12 57 43 0 57 3 rpmC Large ribosomal subunit protein uL29 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NHW0 4.6e-12 57 43 0 57 3 rpmC Large ribosomal subunit protein uL29 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
A0Q4J1 4.6e-12 57 43 0 57 3 rpmC Large ribosomal subunit protein uL29 Francisella tularensis subsp. novicida (strain U112)
B2SDX7 4.6e-12 57 43 0 57 3 rpmC Large ribosomal subunit protein uL29 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q14JB2 4.6e-12 57 43 0 57 3 rpmC Large ribosomal subunit protein uL29 Francisella tularensis subsp. tularensis (strain FSC 198)
A5V5Z4 5.68e-12 57 48 0 62 3 rpmC Large ribosomal subunit protein uL29 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q748Z6 5.68e-12 57 46 0 62 3 rpmC Large ribosomal subunit protein uL29 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q8R7W2 7.45e-12 57 53 0 60 3 rpmC Large ribosomal subunit protein uL29 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q2RQW8 8.63e-12 57 48 0 58 3 rpmC Large ribosomal subunit protein uL29 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q0BNR9 8.68e-12 57 43 0 57 3 rpmC Large ribosomal subunit protein uL29 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A5G2 8.68e-12 57 43 0 57 3 rpmC Large ribosomal subunit protein uL29 Francisella tularensis subsp. holarctica (strain LVS)
B3QBX2 1.19e-11 56 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Rhodopseudomonas palustris (strain TIE-1)
Q6N4U2 1.19e-11 56 41 0 60 1 rpmC Large ribosomal subunit protein uL29 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q5NQ57 1.21e-11 56 47 0 59 3 rpmC Large ribosomal subunit protein uL29 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q04C07 1.5e-11 56 51 0 60 3 rpmC Large ribosomal subunit protein uL29 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBL0 1.5e-11 56 51 0 60 3 rpmC Large ribosomal subunit protein uL29 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
B1YGV8 1.64e-11 56 46 0 60 3 rpmC Large ribosomal subunit protein uL29 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A5ELL9 1.76e-11 56 42 0 56 3 rpmC Large ribosomal subunit protein uL29 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A9H3N9 1.9e-11 56 50 0 58 3 rpmC Large ribosomal subunit protein uL29 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q07KM6 1.92e-11 56 41 0 63 3 rpmC Large ribosomal subunit protein uL29 Rhodopseudomonas palustris (strain BisA53)
A5FZV7 1.92e-11 56 49 0 55 3 rpmC Large ribosomal subunit protein uL29 Acidiphilium cryptum (strain JF-5)
C4KZN8 2.38e-11 55 46 0 60 3 rpmC Large ribosomal subunit protein uL29 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
C5D3S5 2.49e-11 55 46 0 60 3 rpmC Large ribosomal subunit protein uL29 Geobacillus sp. (strain WCH70)
A4IJJ7 2.77e-11 55 45 0 60 3 rpmC Large ribosomal subunit protein uL29 Geobacillus thermodenitrificans (strain NG80-2)
A5D5G3 2.87e-11 55 53 0 60 3 rpmC Large ribosomal subunit protein uL29 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
P04457 3.03e-11 55 46 0 60 1 rpmC Large ribosomal subunit protein uL29 Geobacillus stearothermophilus
Q5L415 3.03e-11 55 46 0 60 3 rpmC Large ribosomal subunit protein uL29 Geobacillus kaustophilus (strain HTA426)
Q89J92 3.46e-11 55 44 0 56 3 rpmC Large ribosomal subunit protein uL29 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A9KJI6 3.51e-11 55 47 0 59 3 rpmC Large ribosomal subunit protein uL29 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
A3DJI0 3.69e-11 55 50 0 60 3 rpmC Large ribosomal subunit protein uL29 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q5FTZ1 3.85e-11 55 48 1 66 3 rpmC Large ribosomal subunit protein uL29 Gluconobacter oxydans (strain 621H)
B5YG39 4.21e-11 55 50 0 61 3 rpmC Large ribosomal subunit protein uL29 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
A2SLE9 4.54e-11 55 50 0 60 3 rpmC Large ribosomal subunit protein uL29 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B9MKH3 4.54e-11 55 46 0 60 3 rpmC Large ribosomal subunit protein uL29 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q3SSV8 5.25e-11 55 36 0 63 3 rpmC Large ribosomal subunit protein uL29 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q83ER8 5.34e-11 55 60 0 60 3 rpmC Large ribosomal subunit protein uL29 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAX8 5.34e-11 55 60 0 60 3 rpmC Large ribosomal subunit protein uL29 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD23 5.34e-11 55 60 0 60 3 rpmC Large ribosomal subunit protein uL29 Coxiella burnetii (strain Dugway 5J108-111)
B6J255 5.34e-11 55 60 0 60 3 rpmC Large ribosomal subunit protein uL29 Coxiella burnetii (strain CbuG_Q212)
B6J5E0 5.34e-11 55 60 0 60 3 rpmC Large ribosomal subunit protein uL29 Coxiella burnetii (strain CbuK_Q154)
A9BPS6 6.5e-11 54 48 0 62 3 rpmC Large ribosomal subunit protein uL29 Delftia acidovorans (strain DSM 14801 / SPH-1)
B0K5Q1 6.55e-11 54 50 0 60 3 rpmC Large ribosomal subunit protein uL29 Thermoanaerobacter sp. (strain X514)
B0KCK8 6.55e-11 54 50 0 60 3 rpmC Large ribosomal subunit protein uL29 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q5FM82 6.65e-11 54 47 0 61 3 rpmC Large ribosomal subunit protein uL29 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
A1TJ15 7.02e-11 54 48 0 62 3 rpmC Large ribosomal subunit protein uL29 Paracidovorax citrulli (strain AAC00-1)
Q18CG9 7.77e-11 54 48 0 60 3 rpmC Large ribosomal subunit protein uL29 Clostridioides difficile (strain 630)
A1W2R5 8.36e-11 54 48 0 62 3 rpmC Large ribosomal subunit protein uL29 Acidovorax sp. (strain JS42)
B9MB81 8.36e-11 54 48 0 62 3 rpmC Large ribosomal subunit protein uL29 Acidovorax ebreus (strain TPSY)
A0L5Y1 8.58e-11 54 46 0 58 3 rpmC Large ribosomal subunit protein uL29 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q21RW6 8.98e-11 54 47 0 63 3 rpmC Large ribosomal subunit protein uL29 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q2RFQ5 1.03e-10 54 50 0 60 3 rpmC Large ribosomal subunit protein uL29 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A9BH97 1.23e-10 53 50 0 60 3 rpmC Large ribosomal subunit protein uL29 Petrotoga mobilis (strain DSM 10674 / SJ95)
B5ELY7 1.31e-10 53 48 0 60 3 rpmC Large ribosomal subunit protein uL29 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J475 1.31e-10 53 48 0 60 3 rpmC Large ribosomal subunit protein uL29 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
C4Z2T8 1.33e-10 53 46 0 56 3 rpmC Large ribosomal subunit protein uL29 Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
Q39XZ8 1.5e-10 53 43 0 62 3 rpmC Large ribosomal subunit protein uL29 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q74L81 1.61e-10 53 46 0 60 3 rpmC Large ribosomal subunit protein uL29 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q6NJC7 2.41e-10 53 49 0 59 3 rpmC Large ribosomal subunit protein uL29 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
A8YXL3 2.7e-10 53 45 0 61 3 rpmC Large ribosomal subunit protein uL29 Lactobacillus helveticus (strain DPC 4571)
A6TWH4 2.74e-10 53 49 0 59 3 rpmC Large ribosomal subunit protein uL29 Alkaliphilus metalliredigens (strain QYMF)
B1I1J6 2.77e-10 53 50 0 60 3 rpmC Large ribosomal subunit protein uL29 Desulforudis audaxviator (strain MP104C)
Q47J95 2.82e-10 53 60 0 61 3 rpmC Large ribosomal subunit protein uL29 Dechloromonas aromatica (strain RCB)
B1W3Z9 3.56e-10 53 52 0 59 3 rpmC Large ribosomal subunit protein uL29 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q82DN7 3.64e-10 53 52 0 59 3 rpmC Large ribosomal subunit protein uL29 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q5P324 3.83e-10 52 63 0 61 3 rpmC Large ribosomal subunit protein uL29 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q3A9S4 4.12e-10 52 47 0 63 3 rpmC Large ribosomal subunit protein uL29 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q0ANQ8 5.34e-10 52 43 0 60 3 rpmC Large ribosomal subunit protein uL29 Maricaulis maris (strain MCS10)
Q12GW3 5.47e-10 52 48 0 58 3 rpmC Large ribosomal subunit protein uL29 Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q9L0D2 5.76e-10 52 52 0 59 3 rpmC Large ribosomal subunit protein uL29 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A5WCJ8 6.33e-10 52 50 0 60 3 rpmC Large ribosomal subunit protein uL29 Psychrobacter sp. (strain PRwf-1)
Q839F6 7.6e-10 52 46 0 62 1 rpmC Large ribosomal subunit protein uL29 Enterococcus faecalis (strain ATCC 700802 / V583)
A4XLS2 8.8e-10 52 46 0 60 3 rpmC Large ribosomal subunit protein uL29 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B8FES7 8.86e-10 51 42 0 59 3 rpmC Large ribosomal subunit protein uL29 Desulfatibacillum aliphaticivorans
A1VEA8 9.25e-10 51 46 0 60 3 rpmC Large ribosomal subunit protein uL29 Nitratidesulfovibrio vulgaris (strain DP4)
Q72CH2 9.25e-10 51 46 0 60 3 rpmC Large ribosomal subunit protein uL29 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
C0ZII8 9.93e-10 51 47 0 57 3 rpmC Large ribosomal subunit protein uL29 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q211F6 1.08e-09 51 38 0 63 3 rpmC Large ribosomal subunit protein uL29 Rhodopseudomonas palustris (strain BisB18)
Q88XX8 1.09e-09 51 50 0 59 3 rpmC Large ribosomal subunit protein uL29 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
C4LL44 1.16e-09 52 49 0 59 3 rpmC Large ribosomal subunit protein uL29 Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
A1AVK8 1.18e-09 51 45 0 60 3 rpmC Large ribosomal subunit protein uL29 Ruthia magnifica subsp. Calyptogena magnifica
Q250M4 1.31e-09 51 45 0 60 3 rpmC Large ribosomal subunit protein uL29 Desulfitobacterium hafniense (strain Y51)
A1WHD3 1.75e-09 51 44 0 63 3 rpmC Large ribosomal subunit protein uL29 Verminephrobacter eiseniae (strain EF01-2)
C4XLY1 1.75e-09 51 45 0 60 3 rpmC Large ribosomal subunit protein uL29 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q4JT55 2.12e-09 51 50 0 59 3 rpmC Large ribosomal subunit protein uL29 Corynebacterium jeikeium (strain K411)
Q65P99 2.14e-09 50 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q6A6N4 2.34e-09 51 46 0 60 1 rpmC Large ribosomal subunit protein uL29 Cutibacterium acnes (strain DSM 16379 / KPA171202)
C0Q9W5 2.46e-09 50 42 0 59 3 rpmC Large ribosomal subunit protein uL29 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q02W32 2.47e-09 50 50 0 56 3 rpmC Large ribosomal subunit protein uL29 Lactococcus lactis subsp. cremoris (strain SK11)
A2RNP7 2.47e-09 50 50 0 56 1 rpmC Large ribosomal subunit protein uL29 Lactococcus lactis subsp. cremoris (strain MG1363)
Q9CDX0 2.47e-09 50 50 0 56 3 rpmC Large ribosomal subunit protein uL29 Lactococcus lactis subsp. lactis (strain IL1403)
A4J119 3.17e-09 50 46 0 60 3 rpmC Large ribosomal subunit protein uL29 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A9VP85 3.31e-09 50 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Bacillus mycoides (strain KBAB4)
A8MLE8 3.39e-09 50 45 0 59 3 rpmC Large ribosomal subunit protein uL29 Alkaliphilus oremlandii (strain OhILAs)
Q03EC4 3.73e-09 50 49 0 57 3 rpmC Large ribosomal subunit protein uL29 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
B8GV50 3.98e-09 50 55 0 61 3 rpmC Large ribosomal subunit protein uL29 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
B0TC64 3.99e-09 50 45 0 60 3 rpmC Large ribosomal subunit protein uL29 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
A1VIQ8 4.55e-09 50 45 0 59 3 rpmC Large ribosomal subunit protein uL29 Polaromonas naphthalenivorans (strain CJ2)
B8G1X4 4.71e-09 50 45 0 60 3 rpmC Large ribosomal subunit protein uL29 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
A7Z0P6 4.96e-09 50 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P12873 4.96e-09 50 41 0 60 1 rpmC Large ribosomal subunit protein uL29 Bacillus subtilis (strain 168)
Q98PZ0 5.01e-09 50 45 0 60 3 rpmC Large ribosomal subunit protein uL29 Mycoplasmopsis pulmonis (strain UAB CTIP)
A5CXL2 5.05e-09 50 43 0 60 3 rpmC Large ribosomal subunit protein uL29 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
B1HMX2 5.24e-09 50 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Lysinibacillus sphaericus (strain C3-41)
Q49ZG0 6.48e-09 49 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A3CK71 6.83e-09 49 51 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus sanguinis (strain SK36)
Q4L8A6 7.15e-09 49 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Staphylococcus haemolyticus (strain JCSC1435)
P66175 7.22e-09 49 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM07 7.22e-09 49 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B9DM39 7.22e-09 49 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Staphylococcus carnosus (strain TM300)
P66174 7.22e-09 49 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Staphylococcus aureus (strain MW2)
A8Z349 7.22e-09 49 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Staphylococcus aureus (strain USA300 / TCH1516)
Q6G779 7.22e-09 49 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Staphylococcus aureus (strain MSSA476)
Q6GEJ1 7.22e-09 49 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Staphylococcus aureus (strain MRSA252)
P66173 7.22e-09 49 41 0 60 1 rpmC Large ribosomal subunit protein uL29 Staphylococcus aureus (strain N315)
P66172 7.22e-09 49 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HDW6 7.22e-09 49 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Staphylococcus aureus (strain COL)
Q2YYN0 7.22e-09 49 41 0 60 1 rpmC Large ribosomal subunit protein uL29 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IV26 7.22e-09 49 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Staphylococcus aureus (strain JH9)
Q2FW14 7.22e-09 49 41 0 60 1 rpmC Large ribosomal subunit protein uL29 Staphylococcus aureus (strain NCTC 8325 / PS 47)
A6U3W7 7.22e-09 49 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Staphylococcus aureus (strain JH1)
A7X5F2 7.22e-09 49 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Staphylococcus aureus (strain Mu3 / ATCC 700698)
A0PXV4 7.23e-09 49 47 0 57 3 rpmC Large ribosomal subunit protein uL29 Clostridium novyi (strain NT)
B1VEU4 7.53e-09 49 48 0 60 3 rpmC Large ribosomal subunit protein uL29 Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
A7GK28 8.67e-09 49 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B7HQV2 8.67e-09 49 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Bacillus cereus (strain AH187)
B7HJ56 8.67e-09 49 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Bacillus cereus (strain B4264)
C1ET47 8.67e-09 49 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Bacillus cereus (strain 03BB102)
B7IT27 8.67e-09 49 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Bacillus cereus (strain G9842)
Q73F88 8.67e-09 49 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JKC7 8.67e-09 49 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Bacillus cereus (strain AH820)
Q81VS2 8.67e-09 49 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Bacillus anthracis
C3LJ90 8.67e-09 49 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P9R3 8.67e-09 49 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Bacillus anthracis (strain A0248)
Q9Z9K6 9.17e-09 49 45 0 60 3 rpmC Large ribosomal subunit protein uL29 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A7NR55 9.47e-09 49 45 0 60 3 rpmC Large ribosomal subunit protein uL29 Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q1WS98 1.02e-08 49 49 0 57 3 rpmC Large ribosomal subunit protein uL29 Ligilactobacillus salivarius (strain UCC118)
Q47LK1 1.03e-08 49 49 0 59 3 rpmC Large ribosomal subunit protein uL29 Thermobifida fusca (strain YX)
Q8ETX5 1.13e-08 48 42 0 57 3 rpmC Large ribosomal subunit protein uL29 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q67JV1 1.16e-08 49 43 0 60 3 rpmC Large ribosomal subunit protein uL29 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q8RIG3 1.17e-08 48 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q034Z1 1.24e-08 48 45 0 61 3 rpmC Large ribosomal subunit protein uL29 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B1KSL7 1.25e-08 48 45 1 62 3 rpmC Large ribosomal subunit protein uL29 Clostridium botulinum (strain Loch Maree / Type A3)
A7GJ66 1.25e-08 48 45 1 62 3 rpmC Large ribosomal subunit protein uL29 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IGE6 1.25e-08 48 45 1 62 3 rpmC Large ribosomal subunit protein uL29 Clostridium botulinum (strain Okra / Type B1)
C1FMU3 1.25e-08 48 45 1 62 3 rpmC Large ribosomal subunit protein uL29 Clostridium botulinum (strain Kyoto / Type A2)
A5I7J8 1.25e-08 48 45 1 62 3 rpmC Large ribosomal subunit protein uL29 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3KVP3 1.25e-08 48 45 1 62 3 rpmC Large ribosomal subunit protein uL29 Clostridium botulinum (strain 657 / Type Ba4)
A7FZ61 1.25e-08 48 45 1 62 3 rpmC Large ribosomal subunit protein uL29 Clostridium botulinum (strain ATCC 19397 / Type A)
Q38US0 1.37e-08 48 49 0 57 3 rpmC Large ribosomal subunit protein uL29 Latilactobacillus sakei subsp. sakei (strain 23K)
Q0RRR3 1.48e-08 49 46 0 58 3 rpmC Large ribosomal subunit protein uL29 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q5WLQ4 1.6e-08 48 43 0 60 3 rpmC Large ribosomal subunit protein uL29 Shouchella clausii (strain KSM-K16)
C1CP96 1.77e-08 48 51 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CIA5 1.77e-08 48 51 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus pneumoniae (strain P1031)
C1CC14 1.77e-08 48 51 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus pneumoniae (strain JJA)
P0A484 1.77e-08 48 51 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IS48 1.77e-08 48 51 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus pneumoniae (strain CGSP14)
P0A483 1.77e-08 48 51 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZKG5 1.77e-08 48 51 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I8K6 1.77e-08 48 51 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus pneumoniae (strain Hungary19A-6)
C1CAM0 1.77e-08 48 51 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus pneumoniae (strain 70585)
B5E6G3 1.77e-08 48 51 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus pneumoniae serotype 19F (strain G54)
Q04MM8 1.77e-08 48 51 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q03PW5 2.03e-08 48 49 0 57 3 rpmC Large ribosomal subunit protein uL29 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
A8AZL7 2.08e-08 48 51 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
B1MGE2 2.1e-08 48 46 0 60 3 rpmC Large ribosomal subunit protein uL29 Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q30Z50 2.58e-08 48 38 0 62 3 rpmC Large ribosomal subunit protein uL29 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
C6E4P9 2.73e-08 48 40 0 62 3 rpmC Large ribosomal subunit protein uL29 Geobacter sp. (strain M21)
B5EFQ8 2.73e-08 48 40 0 62 3 rpmC Large ribosomal subunit protein uL29 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A0ALW0 2.73e-08 48 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P66166 2.73e-08 48 41 0 60 1 rpmC Large ribosomal subunit protein uL29 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DB16 2.73e-08 48 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Listeria monocytogenes serotype 4a (strain HCC23)
Q71WF4 2.73e-08 48 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Listeria monocytogenes serotype 4b (strain F2365)
C1KZH2 2.73e-08 48 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Listeria monocytogenes serotype 4b (strain CLIP80459)
P66167 2.73e-08 48 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B0RZU8 3.33e-08 48 41 0 60 3 rpmC Large ribosomal subunit protein uL29 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
Q03ZN7 3.48e-08 47 46 0 56 3 rpmC Large ribosomal subunit protein uL29 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
B1MW06 3.48e-08 47 46 0 56 3 rpmC Large ribosomal subunit protein uL29 Leuconostoc citreum (strain KM20)
A5N4Q5 3.77e-08 47 42 1 64 3 rpmC Large ribosomal subunit protein uL29 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYB7 3.77e-08 47 42 1 64 3 rpmC Large ribosomal subunit protein uL29 Clostridium kluyveri (strain NBRC 12016)
Q8DS21 4.29e-08 47 51 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B2UYB8 4.44e-08 47 43 1 62 3 rpmC Large ribosomal subunit protein uL29 Clostridium botulinum (strain Alaska E43 / Type E3)
B1XSQ9 4.46e-08 47 43 0 62 3 rpmC Large ribosomal subunit protein uL29 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
B5XJ44 4.58e-08 47 50 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus pyogenes serotype M49 (strain NZ131)
P0DE33 4.58e-08 47 50 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48VU1 4.58e-08 47 50 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RC22 4.58e-08 47 50 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J906 4.58e-08 47 50 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JJ54 4.58e-08 47 50 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JP09 4.58e-08 47 50 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JE50 4.58e-08 47 50 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus pyogenes serotype M12 (strain MGAS2096)
P66178 4.58e-08 47 50 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XEC7 4.58e-08 47 50 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE32 4.58e-08 47 50 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P66176 4.58e-08 47 50 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus pyogenes serotype M1
P66180 4.58e-08 47 50 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P66179 4.58e-08 47 50 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus agalactiae serotype III (strain NEM316)
Q3K3W1 4.58e-08 47 50 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q057B2 5.04e-08 47 48 0 37 3 rpmC Large ribosomal subunit protein uL29 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
C0ZW33 5.25e-08 47 47 0 59 3 rpmC Large ribosomal subunit protein uL29 Rhodococcus erythropolis (strain PR4 / NBRC 100887)
A6LPR9 7.83e-08 47 41 1 62 3 rpmC Large ribosomal subunit protein uL29 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A4VSG2 8.44e-08 47 50 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus suis (strain 05ZYH33)
A4VYQ1 8.44e-08 47 50 0 56 3 rpmC Large ribosomal subunit protein uL29 Streptococcus suis (strain 98HAH33)
B9DSV8 8.82e-08 47 50 0 55 3 rpmC Large ribosomal subunit protein uL29 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
C0MCB8 8.82e-08 47 50 0 55 3 rpmC Large ribosomal subunit protein uL29 Streptococcus equi subsp. zooepidemicus (strain H70)
B4U508 8.82e-08 47 50 0 55 3 rpmC Large ribosomal subunit protein uL29 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M918 8.82e-08 47 50 0 55 3 rpmC Large ribosomal subunit protein uL29 Streptococcus equi subsp. equi (strain 4047)
B2TII3 9.22e-08 47 43 1 62 3 rpmC Large ribosomal subunit protein uL29 Clostridium botulinum (strain Eklund 17B / Type B)
Q8NSZ9 1.01e-07 47 45 0 59 3 rpmC Large ribosomal subunit protein uL29 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QBI9 1.01e-07 47 45 0 59 3 rpmC Large ribosomal subunit protein uL29 Corynebacterium glutamicum (strain R)
B2G8X0 1.05e-07 46 64 1 37 3 rpmC Large ribosomal subunit protein uL29 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VLJ7 1.05e-07 46 64 1 37 3 rpmC Large ribosomal subunit protein uL29 Limosilactobacillus reuteri (strain DSM 20016)
Q1QDH8 1.23e-07 46 47 2 61 3 rpmC Large ribosomal subunit protein uL29 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FUE8 1.23e-07 46 47 2 61 3 rpmC Large ribosomal subunit protein uL29 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q3A6N9 1.32e-07 46 53 0 60 3 rpmC Large ribosomal subunit protein uL29 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B1LBN2 1.44e-07 46 46 0 60 3 rpmC Large ribosomal subunit protein uL29 Thermotoga sp. (strain RQ2)
A5IM91 1.44e-07 46 46 0 60 3 rpmC Large ribosomal subunit protein uL29 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
P38514 1.44e-07 46 46 0 60 1 rpmC Large ribosomal subunit protein uL29 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A5USI1 1.49e-07 46 43 0 60 3 rpmC Large ribosomal subunit protein uL29 Roseiflexus sp. (strain RS-1)
Q03IF9 1.52e-07 46 49 0 55 3 rpmC Large ribosomal subunit protein uL29 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M2C1 1.52e-07 46 49 0 55 3 rpmC Large ribosomal subunit protein uL29 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXR9 1.52e-07 46 49 0 55 3 rpmC Large ribosomal subunit protein uL29 Streptococcus thermophilus (strain CNRZ 1066)
B9M6H0 1.55e-07 46 37 0 62 3 rpmC Large ribosomal subunit protein uL29 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
B9K894 1.73e-07 46 46 0 60 3 rpmC Large ribosomal subunit protein uL29 Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
Q83FZ4 1.74e-07 46 40 0 60 3 rpmC Large ribosomal subunit protein uL29 Tropheryma whipplei (strain Twist)
A8ZV65 1.77e-07 45 37 0 58 3 rpmC Large ribosomal subunit protein uL29 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_18965
Feature type CDS
Gene rpmC
Product 50S ribosomal protein L29
Location 18721 - 18912 (strand: -1)
Length 192 (nucleotides) / 63 (amino acids)
In genomic island -

Contig

Accession ZDB_544
Length 24827 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2424
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00831 Ribosomal L29 protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0255 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L29

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02904 large subunit ribosomal protein L29 Ribosome -

Protein Sequence

MKAKELREKSVEELNTELLNLLREQFNLRMQAASGQLQQSHLLKQVRRNIARVKTLLTEKAGA

Flanking regions ( +/- flanking 50bp)

GCAGCTAAACTGCCTATCAAAACCACCTTTGTAACTAAGACGGTGATGTAATGAAAGCGAAAGAGCTGCGCGAAAAAAGCGTTGAAGAGCTGAACACTGAGCTGCTGAACCTGCTGCGCGAACAATTTAACCTGCGTATGCAAGCGGCAAGCGGCCAGTTACAACAGTCTCATCTGTTAAAACAAGTGCGTCGTAATATTGCACGTGTTAAGACTTTATTGACTGAGAAGGCGGGTGCGTAATGACCGATAAAATCCGTACTCTGCAAGGTCGTGTTGTTAGTGACAAAATG