Homologs in group_2376

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18800 FBDBKF_18800 100.0 Morganella morganii S1 cobO cob(I)yrinic acid a,c-diamide adenosyltransferase
EHELCC_16995 EHELCC_16995 100.0 Morganella morganii S2 cobO cob(I)yrinic acid a,c-diamide adenosyltransferase
LHKJJB_09250 LHKJJB_09250 100.0 Morganella morganii S3 cobO cob(I)yrinic acid a,c-diamide adenosyltransferase
HKOGLL_08800 HKOGLL_08800 100.0 Morganella morganii S5 cobO cob(I)yrinic acid a,c-diamide adenosyltransferase
F4V73_RS13795 F4V73_RS13795 92.9 Morganella psychrotolerans cobO cob(I)yrinic acid a,c-diamide adenosyltransferase
PMI_RS06455 PMI_RS06455 65.3 Proteus mirabilis HI4320 cobO cob(I)yrinic acid a,c-diamide adenosyltransferase

Distribution of the homologs in the orthogroup group_2376

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2376

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P31570 1.58e-102 296 71 0 196 1 btuR Corrinoid adenosyltransferase CobA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A9H5 5.04e-102 295 70 0 196 3 btuR Corrinoid adenosyltransferase Escherichia coli (strain K12)
P0A9H6 5.04e-102 295 70 0 196 3 btuR Corrinoid adenosyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9I472 7.5e-63 196 46 1 196 3 cobO Corrinoid adenosyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P29930 4.7e-46 154 43 3 172 1 cobO Corrinoid adenosyltransferase Sinorhizobium sp.
P46080 3.8e-16 78 30 5 175 4 all2391 Uncharacterized protein all2391 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P46080 2.65e-15 76 28 4 179 4 all2391 Uncharacterized protein all2391 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_18375
Feature type CDS
Gene cobO
Product cob(I)yrinic acid a,c-diamide adenosyltransferase
Location 7544 - 8134 (strand: 1)
Length 591 (nucleotides) / 196 (amino acids)
In genomic island -

Contig

Accession ZDB_541
Length 32595 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2376
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02572 ATP:corrinoid adenosyltransferase BtuR/CobO/CobP
PF12557 Cob(I)alamin adenosyltransferase N terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2109 Coenzyme transport and metabolism (H) H ATP:corrinoid adenosyltransferase

Kegg Ortholog Annotation(s)

Protein Sequence

MSDERYQQRQQKLKEHVDGRVAAAQKTGGVLMVFTGNGKGKSTAAFGTATRATGHGMKVGVVQFIKGQWECGERNVLEKLGVEFHIMATGFTWNTQDKEGDTKAAQEVWQFGKAMLEDPSYDLVVLDELTYMVRYGYIDLDEIISYLKNRPENQSVIITGRGCHRDITDLADTVSELRPVKHAFDSGIQAQKGIDW

Flanking regions ( +/- flanking 50bp)

TGCGTGGCAGGCCAGCCTGCCTGAGCCAACACTTTCCCTGAGGAGTTTGCATGAGCGACGAACGTTATCAACAACGGCAACAGAAACTGAAAGAGCATGTCGACGGGCGCGTTGCCGCGGCTCAGAAGACCGGCGGAGTCCTGATGGTCTTCACCGGTAACGGGAAAGGGAAATCCACAGCGGCCTTTGGTACCGCGACCCGCGCTACCGGACACGGTATGAAAGTGGGCGTGGTGCAGTTTATCAAAGGCCAGTGGGAGTGCGGCGAGCGCAATGTGCTGGAAAAACTGGGGGTTGAGTTCCATATCATGGCCACCGGTTTTACCTGGAACACGCAGGACAAAGAAGGCGATACCAAAGCGGCACAGGAAGTATGGCAGTTCGGCAAAGCGATGTTAGAGGATCCGTCCTATGACCTCGTGGTGCTGGATGAACTGACGTACATGGTGCGCTACGGCTATATCGACCTGGATGAGATTATCAGTTACCTGAAAAATCGCCCAGAAAACCAGAGCGTGATTATTACCGGCCGGGGATGTCACCGTGATATCACTGATCTGGCAGACACCGTCAGTGAGCTGCGCCCGGTTAAACACGCGTTTGACAGTGGTATTCAGGCACAGAAAGGTATCGACTGGTAATTCATCCCGTAAATACAGTCTGTTATTACAATCGCTCCGTTTATACGGGG