Homologs in group_3519

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18260 FBDBKF_18260 100.0 Morganella morganii S1 fosA Catechol 2,3-dioxygenase or related enzyme, vicinal oxygen chelate (VOC) family
EHELCC_18295 EHELCC_18295 100.0 Morganella morganii S2 fosA Catechol 2,3-dioxygenase or related enzyme, vicinal oxygen chelate (VOC) family
LHKJJB_18415 LHKJJB_18415 100.0 Morganella morganii S3 fosA Catechol 2,3-dioxygenase or related enzyme, vicinal oxygen chelate (VOC) family
HKOGLL_18150 HKOGLL_18150 100.0 Morganella morganii S5 fosA Catechol 2,3-dioxygenase or related enzyme, vicinal oxygen chelate (VOC) family

Distribution of the homologs in the orthogroup group_3519

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3519

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q56415 3.03e-49 157 52 1 138 1 fosA Glutathione transferase FosA Serratia marcescens
Q9I4K6 1.45e-45 147 57 1 135 1 fosA Glutathione transferase FosA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
C0ZJ12 1.8e-27 102 40 2 137 3 fosB Metallothiol transferase FosB Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q49VY9 6.91e-27 100 34 1 132 3 fosB Metallothiol transferase FosB Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q81W73 1.72e-26 99 37 2 130 1 fosB2 Metallothiol transferase FosB 2 Bacillus anthracis
C3L6A4 1.72e-26 99 37 2 130 3 fosB2 Metallothiol transferase FosB 2 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P6D6 1.72e-26 99 37 2 130 3 fosB2 Metallothiol transferase FosB 2 Bacillus anthracis (strain A0248)
P60865 4.68e-26 98 33 1 130 3 fosB Metallothiol transferase FosB Bacillus cereus
B7JKN1 1.19e-25 97 36 1 130 3 fosB Metallothiol transferase FosB Bacillus cereus (strain AH820)
Q81RK2 1.19e-25 97 36 1 130 3 fosB1 Metallothiol transferase FosB 1 Bacillus anthracis
C3L5E9 1.19e-25 97 36 1 130 3 fosB1 Metallothiol transferase FosB 1 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P803 1.19e-25 97 36 1 130 3 fosB1 Metallothiol transferase FosB 1 Bacillus anthracis (strain A0248)
Q5WE80 1.45e-25 97 38 2 126 3 fosB Metallothiol transferase FosB Shouchella clausii (strain KSM-K16)
P59291 1.63e-25 97 36 1 125 3 fosB Metallothiol transferase FosB Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q739M9 2.07e-25 97 36 1 130 1 fosB Metallothiol transferase FosB Bacillus cereus (strain ATCC 10987 / NRS 248)
C1ERH6 2.9e-25 96 36 1 130 3 fosB Metallothiol transferase FosB Bacillus cereus (strain 03BB102)
A0RD31 2.9e-25 96 36 1 130 3 fosB Metallothiol transferase FosB Bacillus thuringiensis (strain Al Hakam)
B9IY29 3.92e-25 96 36 1 132 3 fosB Metallothiol transferase FosB Bacillus cereus (strain Q1)
B7HNI5 3.92e-25 96 36 1 132 3 fosB Metallothiol transferase FosB Bacillus cereus (strain AH187)
B7HJF3 3.92e-25 96 34 1 132 3 fosB Metallothiol transferase FosB Bacillus cereus (strain B4264)
B7ITG3 4.37e-25 95 35 1 132 3 fosB Metallothiol transferase FosB Bacillus cereus (strain G9842)
Q6GEA2 4.64e-25 95 37 1 132 3 fosB Metallothiol transferase FosB Staphylococcus aureus (strain MRSA252)
A8Z522 5.58e-25 95 37 1 132 3 fosB Metallothiol transferase FosB Staphylococcus aureus (strain USA300 / TCH1516)
P60864 5.58e-25 95 37 1 132 1 fosB Metallothiol transferase FosB Staphylococcus aureus (strain N315)
P60863 5.58e-25 95 37 1 132 3 fosB Metallothiol transferase FosB Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJH4 5.58e-25 95 37 1 132 3 fosB Metallothiol transferase FosB Staphylococcus aureus (strain Newman)
Q5HDM4 5.58e-25 95 37 1 132 3 fosB Metallothiol transferase FosB Staphylococcus aureus (strain COL)
A5IVB5 5.58e-25 95 37 1 132 3 fosB Metallothiol transferase FosB Staphylococcus aureus (strain JH9)
Q2FVT3 5.58e-25 95 37 1 132 3 fosB Metallothiol transferase FosB Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEG3 5.58e-25 95 37 1 132 3 fosB Metallothiol transferase FosB Staphylococcus aureus (strain USA300)
A6U458 5.58e-25 95 37 1 132 3 fosB Metallothiol transferase FosB Staphylococcus aureus (strain JH1)
A7X5T8 5.58e-25 95 37 1 132 3 fosB Metallothiol transferase FosB Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q63CC5 6.32e-25 95 36 1 130 3 fosB Metallothiol transferase FosB Bacillus cereus (strain ZK / E33L)
A7Z3A4 8.49e-25 95 33 1 129 3 fosB Metallothiol transferase FosB Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q4L2Y9 9.39e-25 95 33 1 132 3 fosB Metallothiol transferase FosB Staphylococcus haemolyticus (strain JCSC1435)
Q55317 9.39e-25 95 33 1 132 3 fosB Metallothiol transferase FosB Staphylococcus haemolyticus
A9VRT9 1.16e-24 95 34 1 132 3 fosB Metallothiol transferase FosB Bacillus mycoides (strain KBAB4)
Q81EF2 1.19e-24 95 34 1 132 3 fosB Metallothiol transferase FosB Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q03377 2.96e-24 94 33 1 132 3 fosB Metallothiol transferase FosB Staphylococcus epidermidis
Q5HKJ6 3.14e-24 94 36 1 125 3 fosB Metallothiol transferase FosB Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A7GNY8 5.73e-24 93 32 1 132 3 fosB Metallothiol transferase FosB Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q6HJT7 6.5e-24 93 35 1 130 3 fosB Metallothiol transferase FosB Bacillus thuringiensis subsp. konkukian (strain 97-27)
B1HZM2 1.52e-23 92 34 2 131 3 fosB Metallothiol transferase FosB Lysinibacillus sphaericus (strain C3-41)
Q9KBZ6 4.62e-23 90 37 1 130 3 fosB Metallothiol transferase FosB Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A4IS40 1.14e-22 90 36 2 124 3 fosB Metallothiol transferase FosB Geobacillus thermodenitrificans (strain NG80-2)
Q8CXK5 2.06e-22 89 34 2 129 3 fosB Metallothiol transferase FosB Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
O31817 8.4e-22 87 37 2 124 1 fosB Metallothiol transferase FosB Bacillus subtilis (strain 168)
Q65KJ5 3.94e-21 86 34 2 124 3 fosB Metallothiol transferase FosB Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q92AV8 2.41e-11 60 28 4 133 3 fosX Fosfomycin resistance protein FosX Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8Y6I2 3.31e-11 60 28 4 133 1 fosX Fosfomycin resistance protein FosX Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q98GG1 1.5e-08 53 25 4 136 1 fosX Fosfomycin resistance protein FosX Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_18220
Feature type CDS
Gene fosA
Product Catechol 2,3-dioxygenase or related enzyme, vicinal oxygen chelate (VOC) family
Location 15889 - 16320 (strand: -1)
Length 432 (nucleotides) / 143 (amino acids)

Contig

Accession ZDB_540
Length 35191 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3519
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF00903 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2514 Secondary metabolites biosynthesis, transport and catabolism (Q) Q Catechol-2,3-dioxygenase

Protein Sequence

MLTGMNHLTLAVADLDRSLHFYRDILKMTLHTRWKYGAYLTCGELWICLSADPEIIHRPIHQGYTHYAFTLPPEQFPAFRSLLAAHQITLWKRNRSEGDSVYFLDPDGHQLEAHSGGIQQRLDACREAPYEEMIFPAPGQINV

Flanking regions ( +/- flanking 50bp)

ACCTGACTCAGACGCGCTGTTTATAACAGCCGGATGCTGACGGAGGATATATGTTAACAGGAATGAATCATCTGACCCTGGCGGTCGCCGATTTGGATCGCAGCCTGCATTTTTACCGCGATATTCTGAAAATGACGCTGCATACCCGCTGGAAATACGGCGCTTACCTGACCTGCGGGGAGTTGTGGATCTGTTTATCAGCAGACCCGGAAATCATTCACCGGCCTATTCATCAGGGTTATACCCACTACGCTTTCACCCTTCCTCCCGAACAGTTCCCGGCCTTCCGCTCGCTTCTCGCTGCTCATCAGATAACACTCTGGAAACGTAACCGCAGTGAAGGTGATTCCGTCTATTTTCTTGACCCGGACGGGCATCAGCTTGAGGCGCATTCCGGCGGAATACAGCAGCGGCTGGATGCCTGCCGCGAAGCGCCGTATGAAGAGATGATATTTCCGGCACCCGGGCAGATTAATGTGTAAGATGGGATAAATCCTTATCTTACGGAGACACTGCTATGTCTGATTACCCA