Homologs in group_3102

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19565 FBDBKF_19565 100.0 Morganella morganii S1 hipB Transcriptional regulator, contains XRE-family HTH domain
EHELCC_16510 EHELCC_16510 100.0 Morganella morganii S2 hipB Transcriptional regulator, contains XRE-family HTH domain
LHKJJB_16750 LHKJJB_16750 100.0 Morganella morganii S3 hipB Transcriptional regulator, contains XRE-family HTH domain
HKOGLL_18865 HKOGLL_18865 100.0 Morganella morganii S5 hipB Transcriptional regulator, contains XRE-family HTH domain
F4V73_RS18565 F4V73_RS18565 71.3 Morganella psychrotolerans - helix-turn-helix transcriptional regulator

Distribution of the homologs in the orthogroup group_3102

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3102

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P55681 5.92e-08 50 37 0 64 4 NGR_a01020 Uncharacterized HTH-type transcriptional regulator y4wC Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P0C5S2 2.15e-06 47 33 0 63 4 R00410 Uncharacterized HTH-type transcriptional regulator R00410 Rhizobium meliloti (strain 1021)
A6U5H5 2.15e-06 47 33 0 63 4 Smed_0045 Uncharacterized HTH-type transcriptional regulator Smed_0045 Sinorhizobium medicae (strain WSM419)
Q9V1R0 2.82e-06 47 37 0 51 3 PYRAB03670 Putative HTH-type transcriptional regulatory protein PYRAB03670 Pyrococcus abyssi (strain GE5 / Orsay)
O59472 5.62e-06 47 37 0 51 3 PH1808 Putative HTH-type transcriptional regulatory protein PH1808 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q97QZ2 6.75e-06 45 35 1 67 1 pezA Antitoxin PezA Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8TZX4 1.21e-05 45 33 0 51 3 PF1851 Putative HTH-type transcriptional regulatory protein PF1851 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P55360 6.01e-05 43 31 1 80 4 NGR_a00350 Uncharacterized HTH-type transcriptional regulator y4aM Sinorhizobium fredii (strain NBRC 101917 / NGR234)
O31943 7.32e-05 42 23 1 89 4 yonR SPbeta prophage-derived uncharacterized HTH-type transcriptional regulator YonR Bacillus subtilis (strain 168)
P69202 0.000227 42 31 0 66 1 C2 Repressor protein C2 Salmonella phage P22
P15017 0.000356 40 29 1 93 4 None Uncharacterized transcriptional regulator in ATPase CF(0) region Rhodospirillum rubrum
Q5JF28 0.000487 41 24 2 98 3 TK0539 Putative HTH-type transcriptional regulatory protein TK0539 Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_16720
Feature type CDS
Gene hipB
Product Transcriptional regulator, contains XRE-family HTH domain
Location 19494 - 19847 (strand: -1)
Length 354 (nucleotides) / 117 (amino acids)

Contig

Accession ZDB_534
Length 68509 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3102
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MSNKTDNNLNTSINEMYKLIGGQIRKMRRITGVTSTELGNLIGVSQQQISRYEIGSTKISLEIILRISQVFGVSPYYFIEDSLLFFTRQHLPDDDNVIPRSTDAGVNTEPETRPPEH

Flanking regions ( +/- flanking 50bp)

AATTTGACAAACATTAATATATTATTGTTTAACCAGACTGACAGATGATAATGAGTAATAAAACAGATAATAACCTGAACACCAGCATTAACGAGATGTACAAGCTTATCGGCGGGCAAATCCGCAAAATGCGCAGGATCACCGGAGTCACATCAACAGAACTGGGCAATCTGATTGGTGTATCACAACAGCAAATCTCCCGTTACGAAATCGGCAGCACAAAAATTTCACTGGAAATTATTCTGAGAATCTCCCAGGTCTTCGGCGTCTCCCCTTACTACTTTATAGAAGACAGTCTGCTGTTCTTTACCCGCCAGCACCTGCCGGATGATGATAACGTTATCCCCCGCAGTACCGACGCCGGTGTAAATACGGAGCCGGAGACCCGGCCACCGGAACACTGAGTGTGTGACAGCACCGCTGATGCGGTGCTGTCTGTTTATACCGGCTGAGT