Homologs in group_2066

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15465 FBDBKF_15465 100.0 Morganella morganii S1 atpB F0F1 ATP synthase subunit A
EHELCC_15825 EHELCC_15825 100.0 Morganella morganii S2 atpB F0F1 ATP synthase subunit A
LHKJJB_16260 LHKJJB_16260 100.0 Morganella morganii S3 atpB F0F1 ATP synthase subunit A
HKOGLL_16030 HKOGLL_16030 100.0 Morganella morganii S5 atpB F0F1 ATP synthase subunit A
F4V73_RS17680 F4V73_RS17680 97.8 Morganella psychrotolerans atpB F0F1 ATP synthase subunit A
PMI_RS15145 PMI_RS15145 92.3 Proteus mirabilis HI4320 atpB F0F1 ATP synthase subunit A

Distribution of the homologs in the orthogroup group_2066

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2066

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F0E1 0.0 512 92 0 274 3 atpB ATP synthase subunit a Proteus mirabilis (strain HI4320)
Q7NA89 1.42e-171 477 85 0 274 3 atpB ATP synthase subunit a Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JTD4 1.57e-170 475 85 0 274 3 atpB ATP synthase subunit a Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JR35 8.04e-169 470 83 0 274 3 atpB ATP synthase subunit a Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q663Q2 8.04e-169 470 83 0 274 3 atpB ATP synthase subunit a Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TSI7 8.04e-169 470 83 0 274 3 atpB ATP synthase subunit a Yersinia pestis (strain Pestoides F)
Q1CCG9 8.04e-169 470 83 0 274 3 atpB ATP synthase subunit a Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CFM3 8.04e-169 470 83 0 274 3 atpB ATP synthase subunit a Yersinia pestis
B2K841 8.04e-169 470 83 0 274 3 atpB ATP synthase subunit a Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C089 8.04e-169 470 83 0 274 3 atpB ATP synthase subunit a Yersinia pestis bv. Antiqua (strain Antiqua)
A7FPE6 8.04e-169 470 83 0 274 3 atpB ATP synthase subunit a Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8G7M2 7.84e-168 468 83 1 274 3 atpB ATP synthase subunit a Serratia proteamaculans (strain 568)
A9R5U5 9.07e-168 468 83 0 274 3 atpB ATP synthase subunit a Yersinia pestis bv. Antiqua (strain Angola)
C5BF34 8.61e-165 460 83 1 272 3 atpB ATP synthase subunit a Edwardsiella ictaluri (strain 93-146)
B5XZL8 1.37e-160 449 81 1 271 3 atpB ATP synthase subunit a Klebsiella pneumoniae (strain 342)
A4WGE9 4.67e-159 446 80 1 271 3 atpB ATP synthase subunit a Enterobacter sp. (strain 638)
A6TG42 4.97e-159 445 82 1 267 3 atpB ATP synthase subunit a Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A8ACP4 2.53e-158 444 80 1 271 3 atpB ATP synthase subunit a Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B2VCB0 2.96e-158 444 83 1 272 3 atpB ATP synthase subunit a Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q2NQ92 4.06e-158 443 79 1 274 3 atpB ATP synthase subunit a Sodalis glossinidius (strain morsitans)
A9MJR3 1.94e-157 441 80 1 271 3 atpB ATP synthase subunit a Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q7CPE3 2.58e-157 441 80 1 271 3 atpB ATP synthase subunit a Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGC2 2.58e-157 441 80 1 271 3 atpB ATP synthase subunit a Salmonella typhi
B4TN37 2.58e-157 441 80 1 271 3 atpB ATP synthase subunit a Salmonella schwarzengrund (strain CVM19633)
B5BIP2 2.58e-157 441 80 1 271 3 atpB ATP synthase subunit a Salmonella paratyphi A (strain AKU_12601)
C0Q2N8 2.58e-157 441 80 1 271 3 atpB ATP synthase subunit a Salmonella paratyphi C (strain RKS4594)
A9MXB2 2.58e-157 441 80 1 271 3 atpB ATP synthase subunit a Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PKW6 2.58e-157 441 80 1 271 3 atpB ATP synthase subunit a Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SYD7 2.58e-157 441 80 1 271 3 atpB ATP synthase subunit a Salmonella newport (strain SL254)
B4TAX8 2.58e-157 441 80 1 271 3 atpB ATP synthase subunit a Salmonella heidelberg (strain SL476)
B5RFV7 2.58e-157 441 80 1 271 3 atpB ATP synthase subunit a Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QVD8 2.58e-157 441 80 1 271 3 atpB ATP synthase subunit a Salmonella enteritidis PT4 (strain P125109)
B5FN39 2.58e-157 441 80 1 271 3 atpB ATP synthase subunit a Salmonella dublin (strain CT_02021853)
Q57HX3 2.58e-157 441 80 1 271 3 atpB ATP synthase subunit a Salmonella choleraesuis (strain SC-B67)
B5EZ02 2.58e-157 441 80 1 271 3 atpB ATP synthase subunit a Salmonella agona (strain SL483)
A7MMW0 5.75e-155 435 81 1 272 3 atpB ATP synthase subunit a Cronobacter sakazakii (strain ATCC BAA-894)
B7LK83 2.01e-152 429 80 1 271 3 atpB ATP synthase subunit a Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R4J4 2.01e-152 429 80 1 271 3 atpB ATP synthase subunit a Escherichia coli (strain UTI89 / UPEC)
B1LL65 2.01e-152 429 80 1 271 3 atpB ATP synthase subunit a Escherichia coli (strain SMS-3-5 / SECEC)
B7NF54 2.01e-152 429 80 1 271 3 atpB ATP synthase subunit a Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q8FBS8 2.01e-152 429 80 1 271 3 atpB ATP synthase subunit a Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAX1 2.01e-152 429 80 1 271 3 atpB ATP synthase subunit a Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AHR8 2.01e-152 429 80 1 271 3 atpB ATP synthase subunit a Escherichia coli O1:K1 / APEC
B7N241 2.01e-152 429 80 1 271 3 atpB ATP synthase subunit a Escherichia coli O81 (strain ED1a)
B7NR40 2.01e-152 429 80 1 271 3 atpB ATP synthase subunit a Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MGF8 2.01e-152 429 80 1 271 3 atpB ATP synthase subunit a Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UMK3 2.01e-152 429 80 1 271 3 atpB ATP synthase subunit a Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q3YVP2 2.2e-151 426 80 1 271 3 atpB ATP synthase subunit a Shigella sonnei (strain Ss046)
Q329S7 2.2e-151 426 79 1 271 3 atpB ATP synthase subunit a Shigella dysenteriae serotype 1 (strain Sd197)
B2TUN7 2.2e-151 426 80 1 271 3 atpB ATP synthase subunit a Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6I3X5 2.2e-151 426 80 1 271 3 atpB ATP synthase subunit a Escherichia coli (strain SE11)
P0AB98 2.2e-151 426 80 1 271 1 atpB ATP synthase subunit a Escherichia coli (strain K12)
B1IX00 2.2e-151 426 80 1 271 3 atpB ATP synthase subunit a Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A6K1 2.2e-151 426 80 1 271 3 atpB ATP synthase subunit a Escherichia coli O9:H4 (strain HS)
B1X9W6 2.2e-151 426 80 1 271 3 atpB ATP synthase subunit a Escherichia coli (strain K12 / DH10B)
C4ZZ16 2.2e-151 426 80 1 271 3 atpB ATP synthase subunit a Escherichia coli (strain K12 / MC4100 / BW2952)
B7M594 2.2e-151 426 80 1 271 3 atpB ATP synthase subunit a Escherichia coli O8 (strain IAI1)
B5YXE2 2.2e-151 426 80 1 271 3 atpB ATP synthase subunit a Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0AB99 2.2e-151 426 80 1 271 3 atpB ATP synthase subunit a Escherichia coli O157:H7
B7L888 2.2e-151 426 80 1 271 3 atpB ATP synthase subunit a Escherichia coli (strain 55989 / EAEC)
A7ZTV0 2.2e-151 426 80 1 271 3 atpB ATP synthase subunit a Escherichia coli O139:H28 (strain E24377A / ETEC)
Q83PJ8 7.25e-151 425 79 1 271 3 atpB ATP synthase subunit a Shigella flexneri
Q0SYT8 7.25e-151 425 79 1 271 3 atpB ATP synthase subunit a Shigella flexneri serotype 5b (strain 8401)
Q6CYI9 2.69e-136 388 70 3 279 3 atpB ATP synthase subunit a Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DJG6 8.41e-136 387 70 3 279 3 atpB ATP synthase subunit a Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A0KQY4 4.08e-133 379 68 2 274 3 atpB ATP synthase subunit a Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4STP9 6.14e-132 377 67 2 274 3 atpB ATP synthase subunit a Aeromonas salmonicida (strain A449)
C4LDW6 2.07e-131 375 66 2 274 3 atpB ATP synthase subunit a Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
O51878 2.28e-126 363 66 1 264 3 atpB ATP synthase subunit a Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57118 1.36e-125 361 65 1 264 3 atpB ATP synthase subunit a Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q1LTU8 6.59e-123 354 63 2 269 3 atpB ATP synthase subunit a Baumannia cicadellinicola subsp. Homalodisca coagulata
Q6LLG2 8.72e-122 351 61 1 274 3 atpB1 ATP synthase subunit a 1 Photobacterium profundum (strain SS9)
B5FCZ7 1.07e-120 348 61 2 273 3 atpB ATP synthase subunit a Aliivibrio fischeri (strain MJ11)
Q5E1N1 1.07e-120 348 61 2 273 3 atpB ATP synthase subunit a Aliivibrio fischeri (strain ATCC 700601 / ES114)
A7N0Y8 1.09e-119 346 61 2 273 3 atpB1 ATP synthase subunit a 1 Vibrio campbellii (strain ATCC BAA-1116)
B6EHU3 1.79e-119 345 61 3 273 3 atpB ATP synthase subunit a Aliivibrio salmonicida (strain LFI1238)
Q87KA3 3.12e-119 345 61 2 273 3 atpB ATP synthase subunit a Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P12984 4.33e-119 344 61 2 273 3 atpB ATP synthase subunit a Vibrio alginolyticus
Q494C9 4.47e-119 344 62 2 270 3 atpB ATP synthase subunit a Blochmanniella pennsylvanica (strain BPEN)
Q8D3J9 5.26e-118 342 60 2 274 3 atpB ATP synthase subunit a Wigglesworthia glossinidia brevipalpis
C3LSJ5 1.19e-117 341 59 2 274 3 atpB ATP synthase subunit a Vibrio cholerae serotype O1 (strain M66-2)
Q9KNG9 1.19e-117 341 59 2 274 3 atpB ATP synthase subunit a Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F473 1.19e-117 341 59 2 274 3 atpB ATP synthase subunit a Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A1T0Z5 2.46e-117 340 62 1 267 3 atpB ATP synthase subunit a Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A1RQB6 1.5e-116 338 60 1 274 3 atpB ATP synthase subunit a Shewanella sp. (strain W3-18-1)
A4YCI4 1.5e-116 338 60 1 274 3 atpB ATP synthase subunit a Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q7VQW2 4.48e-115 334 60 1 265 3 atpB ATP synthase subunit a Blochmanniella floridana
B0TQG0 1.94e-113 330 58 2 277 3 atpB ATP synthase subunit a Shewanella halifaxensis (strain HAW-EB4)
A6WUJ6 3.4e-113 330 60 3 281 3 atpB ATP synthase subunit a Shewanella baltica (strain OS185)
Q7MGH4 3.83e-113 329 58 2 273 3 atpB ATP synthase subunit a Vibrio vulnificus (strain YJ016)
Q8DDH4 3.83e-113 329 58 2 273 3 atpB ATP synthase subunit a Vibrio vulnificus (strain CMCP6)
A8HAG9 1.34e-112 328 58 2 277 3 atpB ATP synthase subunit a Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B1KQ40 1.83e-109 320 59 4 281 3 atpB ATP synthase subunit a Shewanella woodyi (strain ATCC 51908 / MS32)
Q0HPF5 2.26e-109 320 59 4 281 3 atpB ATP synthase subunit a Shewanella sp. (strain MR-7)
Q0HD73 2.26e-109 320 59 4 281 3 atpB ATP synthase subunit a Shewanella sp. (strain MR-4)
A0L2T4 1.01e-108 318 59 4 281 3 atpB ATP synthase subunit a Shewanella sp. (strain ANA-3)
A9KX12 4.66e-108 316 58 4 281 3 atpB ATP synthase subunit a Shewanella baltica (strain OS195)
A3DAS0 4.66e-108 316 58 4 281 3 atpB ATP synthase subunit a Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EDV6 4.66e-108 316 58 4 281 3 atpB ATP synthase subunit a Shewanella baltica (strain OS223)
Q8E8B4 5.8e-108 316 58 4 281 3 atpB ATP synthase subunit a Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A1SBU6 8.32e-108 315 57 4 281 3 atpB ATP synthase subunit a Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B8CVV1 1.15e-106 313 58 4 281 3 atpB ATP synthase subunit a Shewanella piezotolerans (strain WP3 / JCM 13877)
Q07VT8 3.34e-106 311 58 4 281 3 atpB ATP synthase subunit a Shewanella frigidimarina (strain NCIMB 400)
A3QJR6 5.41e-106 311 57 4 281 3 atpB ATP synthase subunit a Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A8G1X1 5.97e-106 311 58 4 281 3 atpB ATP synthase subunit a Shewanella sediminis (strain HAW-EB3)
Q12HP5 1.06e-105 310 57 4 281 3 atpB ATP synthase subunit a Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q89B45 5.62e-104 306 58 1 247 3 atpB ATP synthase subunit a Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B0VBM6 6.58e-102 301 56 6 292 3 atpB ATP synthase subunit a Acinetobacter baumannii (strain AYE)
A3M137 6.58e-102 301 56 6 292 1 atpB ATP synthase subunit a Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2I0Z6 6.58e-102 301 56 6 292 3 atpB ATP synthase subunit a Acinetobacter baumannii (strain ACICU)
B7I1V8 6.58e-102 301 56 6 292 3 atpB ATP synthase subunit a Acinetobacter baumannii (strain AB0057)
B7H2A0 6.58e-102 301 56 6 292 3 atpB ATP synthase subunit a Acinetobacter baumannii (strain AB307-0294)
Q6FFK6 2.29e-101 300 55 6 292 3 atpB ATP synthase subunit a Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B0VNJ8 2.69e-101 300 56 6 292 3 atpB ATP synthase subunit a Acinetobacter baumannii (strain SDF)
Q2S6N5 5.48e-100 296 55 5 278 3 atpB2 ATP synthase subunit a 2 Hahella chejuensis (strain KCTC 2396)
Q60CS0 6.65e-100 295 62 2 235 3 atpB1 ATP synthase subunit a 1 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A7N2U2 1.16e-99 295 56 3 266 3 atpB2 ATP synthase subunit a 2 Vibrio campbellii (strain ATCC BAA-1116)
A6W3T4 1.44e-98 293 56 6 281 3 atpB ATP synthase subunit a Marinomonas sp. (strain MWYL1)
B4RS87 2.29e-98 292 55 3 274 3 atpB ATP synthase subunit a Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q1Q893 2.21e-97 290 56 6 289 3 atpB ATP synthase subunit a Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q5QZI0 2.41e-97 289 53 5 280 3 atpB ATP synthase subunit a Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A4VS68 6.16e-97 289 54 4 282 3 atpB ATP synthase subunit a Stutzerimonas stutzeri (strain A1501)
Q6LL02 1.92e-96 286 54 3 266 3 atpB2 ATP synthase subunit a 2 Photobacterium profundum (strain SS9)
Q4FQ31 7.99e-96 286 56 7 289 3 atpB ATP synthase subunit a Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q48AW6 6.01e-95 283 53 3 276 3 atpB ATP synthase subunit a Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A5WBV5 7.24e-95 283 53 6 288 3 atpB ATP synthase subunit a Psychrobacter sp. (strain PRwf-1)
B8F768 1.22e-94 282 56 4 272 3 atpB ATP synthase subunit a Glaesserella parasuis serovar 5 (strain SH0165)
Q1QSC4 1.57e-94 283 53 6 288 3 atpB ATP synthase subunit a Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A4Y193 1.22e-93 280 54 3 270 3 atpB ATP synthase subunit a Pseudomonas mendocina (strain ymp)
B3H2P9 1.36e-93 280 56 4 271 3 atpB ATP synthase subunit a Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0BRX8 3.09e-93 278 56 4 271 3 atpB ATP synthase subunit a Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Q7VPP6 3.19e-93 278 56 4 273 3 atpB ATP synthase subunit a Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q3IK44 3.83e-93 279 51 4 285 3 atpB ATP synthase subunit a Pseudoalteromonas translucida (strain TAC 125)
A3N2V0 1.75e-92 276 56 4 271 3 atpB ATP synthase subunit a Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q9CKW6 1.94e-92 276 53 4 278 3 atpB ATP synthase subunit a Pasteurella multocida (strain Pm70)
Q65Q01 3.19e-92 276 54 5 278 3 atpB ATP synthase subunit a Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q15MT8 4.39e-91 273 52 3 285 3 atpB ATP synthase subunit a Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
P43719 4.68e-91 273 53 5 278 3 atpB ATP synthase subunit a Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UGZ5 4.68e-91 273 53 5 278 3 atpB ATP synthase subunit a Haemophilus influenzae (strain PittGG)
Q4QN58 4.68e-91 273 53 5 278 3 atpB ATP synthase subunit a Haemophilus influenzae (strain 86-028NP)
A5UA05 5.27e-91 273 53 4 273 3 atpB ATP synthase subunit a Haemophilus influenzae (strain PittEE)
A1U7I0 2.38e-90 272 54 4 282 3 atpB ATP synthase subunit a Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q4K3A3 3.09e-90 272 54 6 285 3 atpB ATP synthase subunit a Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B0UWH1 4.15e-90 271 54 4 273 3 atpB ATP synthase subunit a Histophilus somni (strain 2336)
A6VL63 9.59e-90 270 53 4 273 3 atpB ATP synthase subunit a Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q0I5W7 1.08e-89 270 54 4 273 3 atpB ATP synthase subunit a Histophilus somni (strain 129Pt)
Q83AG1 8.98e-89 267 50 4 268 3 atpB ATP synthase subunit a Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
B6J957 8.98e-89 267 50 4 268 3 atpB ATP synthase subunit a Coxiella burnetii (strain CbuK_Q154)
A1AXU8 9.08e-89 268 50 6 284 3 atpB ATP synthase subunit a Ruthia magnifica subsp. Calyptogena magnifica
B6J2D4 1.84e-88 266 50 4 268 3 atpB ATP synthase subunit a Coxiella burnetii (strain CbuG_Q212)
A9NBC4 2.29e-88 266 50 4 268 3 atpB ATP synthase subunit a Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KBG3 3.18e-88 266 50 4 268 3 atpB ATP synthase subunit a Coxiella burnetii (strain Dugway 5J108-111)
Q3SF60 5.08e-88 266 52 6 280 3 atpB ATP synthase subunit a Thiobacillus denitrificans (strain ATCC 25259)
Q87TS8 1.51e-87 265 53 5 284 3 atpB ATP synthase subunit a Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48BF9 1.81e-87 265 53 6 288 3 atpB ATP synthase subunit a Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
C3K1F2 4.06e-87 264 53 5 284 3 atpB ATP synthase subunit a Pseudomonas fluorescens (strain SBW25)
B1JFU7 4.24e-87 264 53 5 284 3 atpB ATP synthase subunit a Pseudomonas putida (strain W619)
B0KRB4 4.24e-87 264 53 5 284 3 atpB ATP synthase subunit a Pseudomonas putida (strain GB-1)
Q88BW8 1.09e-86 263 53 5 284 3 atpB ATP synthase subunit a Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q0A4M2 1.1e-86 261 51 5 268 3 atpB ATP synthase subunit a Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q3K435 1.35e-86 263 53 6 287 3 atpB ATP synthase subunit a Pseudomonas fluorescens (strain Pf0-1)
A5WBA9 1.35e-86 263 53 5 284 3 atpB ATP synthase subunit a Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q4ZL18 1.44e-86 263 53 5 284 3 atpB ATP synthase subunit a Pseudomonas syringae pv. syringae (strain B728a)
Q1I2I1 1.02e-85 260 51 5 284 3 atpB ATP synthase subunit a Pseudomonas entomophila (strain L48)
Q9HT14 3.89e-83 254 51 6 285 3 atpB ATP synthase subunit a Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02DE8 3.89e-83 254 51 6 285 3 atpB ATP synthase subunit a Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V797 3.89e-83 254 51 6 285 3 atpB ATP synthase subunit a Pseudomonas aeruginosa (strain LESB58)
A6VF38 3.89e-83 254 51 6 285 3 atpB ATP synthase subunit a Pseudomonas aeruginosa (strain PA7)
A1WZT7 7.74e-83 252 50 6 274 3 atpB ATP synthase subunit a Halorhodospira halophila (strain DSM 244 / SL1)
Q0VKW8 2.93e-80 247 48 7 299 3 atpB ATP synthase subunit a Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q7P0A1 1.3e-79 244 51 5 255 3 atpB ATP synthase subunit a Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q82XQ4 4.18e-75 233 46 5 281 3 atpB ATP synthase subunit a Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A1TJ35 8.11e-73 228 45 6 301 3 atpB ATP synthase subunit a Paracidovorax citrulli (strain AAC00-1)
Q21DK2 1.51e-72 228 42 5 307 3 atpB ATP synthase subunit a Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A1K1R6 1.37e-69 219 45 7 289 3 atpB ATP synthase subunit a Azoarcus sp. (strain BH72)
C5BKK1 2.08e-69 219 40 5 307 3 atpB ATP synthase subunit a Teredinibacter turnerae (strain ATCC 39867 / T7901)
A5EXK1 9.87e-68 214 41 6 279 3 atpB ATP synthase subunit a Dichelobacter nodosus (strain VCS1703A)
A6T476 1.07e-66 211 44 7 287 3 atpB ATP synthase subunit a Janthinobacterium sp. (strain Marseille)
B9MB97 1.24e-63 204 45 6 296 3 atpB ATP synthase subunit a Acidovorax ebreus (strain TPSY)
Q2KU30 1.24e-62 201 43 10 303 3 atpB ATP synthase subunit a Bordetella avium (strain 197N)
A1W2T1 2.24e-62 201 44 6 296 3 atpB ATP synthase subunit a Acidovorax sp. (strain JS42)
A1WF52 2.05e-58 191 41 7 296 3 atpB ATP synthase subunit a Verminephrobacter eiseniae (strain EF01-2)
A9HY34 2.66e-56 185 40 10 303 3 atpB ATP synthase subunit a Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q7VU50 8.36e-56 184 43 10 303 3 atpB ATP synthase subunit a Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W3A4 8.36e-56 184 43 10 303 3 atpB ATP synthase subunit a Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WEM3 8.36e-56 184 43 10 303 3 atpB ATP synthase subunit a Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P25761 1.27e-35 127 48 3 147 3 atpB ATP synthase subunit a (Fragment) Pseudomonas putida
A0LSL0 2.96e-29 114 32 10 270 3 atpB ATP synthase subunit a Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
P9WPV7 9.37e-23 97 32 7 249 1 atpB ATP synthase subunit a Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WPV6 9.37e-23 97 32 7 249 3 atpB ATP synthase subunit a Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63655 9.37e-23 97 32 7 249 3 atpB ATP synthase subunit a Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0PUK6 2.26e-22 95 32 8 245 3 atpB ATP synthase subunit a Mycobacterium ulcerans (strain Agy99)
B2HQK8 7.09e-22 94 32 8 245 3 atpB ATP synthase subunit a Mycobacterium marinum (strain ATCC BAA-535 / M)
Q7A0C2 1.79e-21 93 33 12 226 3 atpB ATP synthase subunit a Staphylococcus aureus (strain MW2)
A8YY76 1.79e-21 93 33 12 226 3 atpB ATP synthase subunit a Staphylococcus aureus (strain USA300 / TCH1516)
Q6G7K1 1.79e-21 93 33 12 226 3 atpB ATP synthase subunit a Staphylococcus aureus (strain MSSA476)
Q6GEW6 1.79e-21 93 33 12 226 3 atpB ATP synthase subunit a Staphylococcus aureus (strain MRSA252)
Q7A4E5 1.79e-21 93 33 12 226 1 atpB ATP synthase subunit a Staphylococcus aureus (strain N315)
Q99SE9 1.79e-21 93 33 12 226 3 atpB ATP synthase subunit a Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QIV3 1.79e-21 93 33 12 226 3 atpB ATP synthase subunit a Staphylococcus aureus (strain Newman)
Q5HE91 1.79e-21 93 33 12 226 3 atpB ATP synthase subunit a Staphylococcus aureus (strain COL)
Q2YUJ5 1.79e-21 93 33 12 226 3 atpB ATP synthase subunit a Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IUQ4 1.79e-21 93 33 12 226 3 atpB ATP synthase subunit a Staphylococcus aureus (strain JH9)
Q2G2F4 1.79e-21 93 33 12 226 3 atpB ATP synthase subunit a Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FF18 1.79e-21 93 33 12 226 3 atpB ATP synthase subunit a Staphylococcus aureus (strain USA300)
A6U3J4 1.79e-21 93 33 12 226 3 atpB ATP synthase subunit a Staphylococcus aureus (strain JH1)
A7X4V1 1.79e-21 93 33 12 226 3 atpB ATP synthase subunit a Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q5HA45 3.1e-21 92 30 6 247 3 atpB ATP synthase subunit a Ehrlichia ruminantium (strain Welgevonden)
Q5FGK8 3.1e-21 92 30 6 247 3 atpB ATP synthase subunit a Ehrlichia ruminantium (strain Gardel)
A1AP45 7.08e-21 91 32 6 208 3 atpB3 ATP synthase subunit a 3 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B2V9G8 1.16e-19 87 31 6 215 3 atpB ATP synthase subunit a Sulfurihydrogenibium sp. (strain YO3AOP1)
Q8EM77 1.21e-19 88 28 10 241 3 atpB ATP synthase subunit a Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A1ALL0 1.32e-19 88 32 6 209 3 atpB1 ATP synthase subunit a 1 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q3YQV2 3.66e-19 87 30 7 247 3 atpB ATP synthase subunit a Ehrlichia canis (strain Jake)
P15012 5e-19 86 30 5 214 3 atpB ATP synthase subunit a Rhodospirillum rubrum
Q2RPA4 5e-19 86 30 5 214 3 atpB ATP synthase subunit a Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q39QA3 5.22e-19 86 32 7 221 3 atpB ATP synthase subunit a Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q3A603 7.96e-19 86 30 4 208 3 atpB2 ATP synthase subunit a 2 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q2GFB2 1.02e-18 85 30 7 247 3 atpB ATP synthase subunit a Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q74GB2 1.82e-18 85 32 7 212 3 atpB ATP synthase subunit a Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B9LZL3 2.3e-18 84 30 5 210 3 atpB ATP synthase subunit a Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
P45829 4e-18 84 31 6 207 3 atpB ATP synthase subunit a Mycobacterium leprae (strain TN)
A7Z9Q6 8.25e-18 83 30 10 249 3 atpB ATP synthase subunit a Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q5P9R8 1.44e-17 82 30 5 242 3 atpB ATP synthase subunit a Anaplasma marginale (strain St. Maries)
A7IGT0 1.5e-17 82 30 7 239 3 atpB ATP synthase subunit a Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q830Z9 2.81e-17 82 33 6 207 3 atpB ATP synthase subunit a Enterococcus faecalis (strain ATCC 700802 / V583)
B9DMF0 2.93e-17 82 35 8 157 3 atpB ATP synthase subunit a Staphylococcus carnosus (strain TM300)
A5G9C3 4.94e-17 81 30 5 210 3 atpB ATP synthase subunit a Geotalea uraniireducens (strain Rf4)
Q2LVX0 1.02e-16 80 30 4 206 3 atpB ATP synthase subunit a Syntrophus aciditrophicus (strain SB)
Q2GE13 1.64e-16 80 29 4 240 3 atpB ATP synthase subunit a Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
C0R5U3 2.68e-16 79 30 6 233 3 atpB ATP synthase subunit a Wolbachia sp. subsp. Drosophila simulans (strain wRi)
A1BJW6 2.76e-16 80 31 9 235 3 atpB ATP synthase subunit a Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q2RFX3 3.12e-16 78 28 6 209 1 atpB ATP synthase subunit a Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
P37813 3.48e-16 79 30 10 249 1 atpB ATP synthase subunit a Bacillus subtilis (strain 168)
B2G685 3.83e-16 79 31 10 257 3 atpB ATP synthase subunit a Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VIQ5 3.83e-16 79 31 10 257 3 atpB ATP synthase subunit a Limosilactobacillus reuteri (strain DSM 20016)
Q73HW3 4.58e-16 78 30 6 233 3 atpB ATP synthase subunit a Wolbachia pipientis wMel
Q1AVH3 8.95e-16 78 28 10 254 3 atpB ATP synthase subunit a Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
P20600 9.36e-16 77 31 9 219 3 atpB ATP synthase subunit a Priestia megaterium (strain ATCC 12872 / QMB1551)
P43454 9.82e-16 77 31 7 228 3 atpB ATP synthase subunit a Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R)
B0ULY1 1.14e-15 77 31 7 235 3 atpB ATP synthase subunit a Methylobacterium sp. (strain 4-46)
B3CLG3 1.46e-15 77 32 7 228 3 atpB ATP synthase subunit a Wolbachia pipientis subsp. Culex pipiens (strain wPip)
A4J9A5 1.78e-15 77 28 9 228 3 atpB ATP synthase subunit a Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q3A8L4 2.55e-15 76 28 4 206 3 atpB1 ATP synthase subunit a 1 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
C6E8P0 2.68e-15 76 30 7 210 3 atpB ATP synthase subunit a Geobacter sp. (strain M21)
B5EFG8 2.68e-15 76 30 7 210 3 atpB ATP synthase subunit a Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B3E9X3 4.04e-15 75 28 5 209 3 atpB ATP synthase subunit a Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q2W028 4.3e-15 76 28 6 237 3 atpB ATP synthase subunit a Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A4Z2B4 6.74e-15 75 28 6 210 3 atpB ATP synthase subunit a Bradyrhizobium sp. (strain ORS 278)
P09218 6.77e-15 75 36 6 138 1 atpB ATP synthase subunit a Bacillus sp. (strain PS3)
A8FIB8 7.8e-15 75 29 12 263 3 atpB ATP synthase subunit a Bacillus pumilus (strain SAFR-032)
Q5KUI7 8.07e-15 75 36 5 136 3 atpB ATP synthase subunit a Geobacillus kaustophilus (strain HTA426)
Q2G8R3 1.03e-14 75 29 5 215 3 atpB ATP synthase subunit a Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
A8GQF6 1.13e-14 75 27 5 227 3 atpB ATP synthase subunit a Rickettsia rickettsii (strain Sheila Smith)
B0BVU2 1.13e-14 75 27 5 227 3 atpB ATP synthase subunit a Rickettsia rickettsii (strain Iowa)
B6JDD0 1.22e-14 75 29 5 210 3 atpB ATP synthase subunit a Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
P42010 1.26e-14 74 36 6 136 3 atpB ATP synthase subunit a Geobacillus stearothermophilus
Q92JP0 1.86e-14 74 28 4 208 3 atpB ATP synthase subunit a Rickettsia conorii (strain ATCC VR-613 / Malish 7)
A7H2H4 2.19e-14 73 32 6 227 3 atpB ATP synthase subunit a Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
B3QZE8 2.26e-14 75 26 7 222 3 atpB ATP synthase subunit a Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
A5EAB4 2.41e-14 73 27 6 210 3 atpB1 ATP synthase subunit a 1 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q0AMJ4 2.42e-14 74 27 8 238 3 atpB ATP synthase subunit a Maricaulis maris (strain MCS10)
Q13CX1 2.54e-14 73 28 6 210 3 atpB ATP synthase subunit a Rhodopseudomonas palustris (strain BisB5)
Q2GIS5 2.77e-14 73 30 4 214 3 atpB ATP synthase subunit a Anaplasma phagocytophilum (strain HZ)
C4K0P3 3.12e-14 73 28 4 208 3 atpB ATP synthase subunit a Rickettsia peacockii (strain Rustic)
Q3IZ12 4.6e-14 73 31 6 202 3 atpB ATP synthase subunit a Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PN85 4.6e-14 73 31 6 202 3 atpB ATP synthase subunit a Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q8KGE7 5.35e-14 74 29 8 219 3 atpB2 ATP synthase subunit a 2 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B1WXB4 5.56e-14 72 26 6 193 3 atpB1 ATP synthase subunit a 1 Crocosphaera subtropica (strain ATCC 51142 / BH68)
A4WNY6 5.83e-14 73 31 6 202 3 atpB ATP synthase subunit a Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
B9JA28 5.85e-14 73 28 6 232 3 atpB ATP synthase subunit a Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B4SH40 6.55e-14 73 30 9 238 3 atpB ATP synthase subunit a Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
A7GYS2 6.61e-14 72 32 10 225 3 atpB ATP synthase subunit a Campylobacter curvus (strain 525.92)
Q3ANW6 7.67e-14 73 30 7 208 3 atpB ATP synthase subunit a Chlorobium chlorochromatii (strain CaD3)
A2RFC7 8.29e-14 72 29 9 222 3 atpB ATP synthase subunit a Streptococcus pyogenes serotype M5 (strain Manfredo)
Q0P952 8.45e-14 72 32 6 227 3 atpB ATP synthase subunit a Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FMQ9 8.45e-14 72 32 6 227 3 atpB ATP synthase subunit a Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
B5XKP6 8.71e-14 72 29 9 222 3 atpB ATP synthase subunit a Streptococcus pyogenes serotype M49 (strain NZ131)
P0CZ91 8.71e-14 72 29 9 222 3 atpB ATP synthase subunit a Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48UD8 8.71e-14 72 29 9 222 3 atpB ATP synthase subunit a Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1J7G4 8.71e-14 72 29 9 222 3 atpB ATP synthase subunit a Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JHP0 8.71e-14 72 29 9 222 3 atpB ATP synthase subunit a Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JMJ4 8.71e-14 72 29 9 222 3 atpB ATP synthase subunit a Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JCL8 8.71e-14 72 29 9 222 3 atpB ATP synthase subunit a Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q7CND5 8.71e-14 72 29 9 222 3 atpB ATP synthase subunit a Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XCY5 8.71e-14 72 29 9 222 3 atpB ATP synthase subunit a Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ90 8.71e-14 72 29 9 222 3 atpB ATP synthase subunit a Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q9A0J2 8.71e-14 72 29 9 222 3 atpB ATP synthase subunit a Streptococcus pyogenes serotype M1
Q2Y8G6 8.99e-14 72 25 7 212 3 atpB ATP synthase subunit a Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q4UNH7 1.02e-13 72 27 4 208 3 atpB ATP synthase subunit a Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A8F0C9 1.11e-13 72 27 4 208 3 atpB ATP synthase subunit a Rickettsia massiliae (strain Mtu5)
C3PM51 1.18e-13 72 27 4 208 3 atpB ATP synthase subunit a Rickettsia africae (strain ESF-5)
A0RP13 1.3e-13 71 29 7 230 3 atpB ATP synthase subunit a Campylobacter fetus subsp. fetus (strain 82-40)
B2GAT9 1.38e-13 71 31 12 255 3 atpB ATP synthase subunit a Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q2IRA6 1.47e-13 72 27 6 210 3 atpB ATP synthase subunit a Rhodopseudomonas palustris (strain HaA2)
Q5HTR0 1.48e-13 71 32 6 227 3 atpB ATP synthase subunit a Campylobacter jejuni (strain RM1221)
A1W0I8 1.48e-13 71 32 6 227 3 atpB ATP synthase subunit a Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q5GSH6 1.49e-13 71 29 6 233 3 atpB ATP synthase subunit a Wolbachia sp. subsp. Brugia malayi (strain TRS)
A5VNW2 1.68e-13 71 27 6 232 3 atpB ATP synthase subunit a Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8G2E1 1.72e-13 71 27 6 232 3 atpB ATP synthase subunit a Brucella suis biovar 1 (strain 1330)
B0CK70 1.72e-13 71 27 6 232 3 atpB ATP synthase subunit a Brucella suis (strain ATCC 23445 / NCTC 10510)
Q8YFH6 1.72e-13 71 27 6 232 3 atpB ATP synthase subunit a Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RH93 1.72e-13 71 27 6 232 3 atpB ATP synthase subunit a Brucella melitensis biotype 2 (strain ATCC 23457)
A9M8F8 1.72e-13 71 27 6 232 3 atpB ATP synthase subunit a Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57EY0 1.72e-13 71 27 6 232 3 atpB ATP synthase subunit a Brucella abortus biovar 1 (strain 9-941)
Q2YM92 1.72e-13 71 27 6 232 3 atpB ATP synthase subunit a Brucella abortus (strain 2308)
B2S9M8 1.72e-13 71 27 6 232 3 atpB ATP synthase subunit a Brucella abortus (strain S19)
Q1RGZ3 1.81e-13 71 28 4 208 3 atpB ATP synthase subunit a Rickettsia bellii (strain RML369-C)
B4U8V3 2.09e-13 70 31 7 210 3 atpB ATP synthase subunit a Hydrogenobaculum sp. (strain Y04AAS1)
A8GUJ3 2.12e-13 71 28 4 208 3 atpB ATP synthase subunit a Rickettsia bellii (strain OSU 85-389)
Q3B141 2.17e-13 72 26 11 290 3 atpB2 ATP synthase subunit a 2 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
B3QF37 2.44e-13 71 27 6 210 3 atpB ATP synthase subunit a Rhodopseudomonas palustris (strain TIE-1)
Q6NBI2 2.44e-13 71 27 6 210 3 atpB ATP synthase subunit a Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q7MAD5 2.86e-13 70 28 9 236 3 atpB ATP synthase subunit a Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
B8J4L9 2.9e-13 70 29 8 219 3 atpB ATP synthase subunit a Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q8Y4B6 3.01e-13 70 29 8 226 3 atpB ATP synthase subunit a Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q4FPE9 3.3e-13 70 28 6 231 3 atpB ATP synthase subunit a Pelagibacter ubique (strain HTCC1062)
B2KEW6 4.73e-13 70 27 8 243 3 atpB ATP synthase subunit a Elusimicrobium minutum (strain Pei191)
O05330 5.76e-13 70 27 5 227 1 atpB ATP synthase subunit a Rhodobacter capsulatus
Q71WP3 6.02e-13 70 29 7 217 3 atpB ATP synthase subunit a Listeria monocytogenes serotype 4b (strain F2365)
C1KYV2 6.02e-13 70 29 7 217 3 atpB ATP synthase subunit a Listeria monocytogenes serotype 4b (strain CLIP80459)
Q927V8 6.02e-13 70 29 7 217 3 atpB ATP synthase subunit a Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q89V68 6.24e-13 70 27 5 211 3 atpB ATP synthase subunit a Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q1MPG6 6.7e-13 69 29 7 211 3 atpB ATP synthase subunit a Lawsonia intracellularis (strain PHE/MN1-00)
A8ZNS1 7.29e-13 69 24 8 233 3 atpB2 ATP synthase subunit a 2 Acaryochloris marina (strain MBIC 11017)
B2IGL1 7.84e-13 70 26 5 217 3 atpB ATP synthase subunit a Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
A0ALL9 8.42e-13 69 36 4 136 3 atpB ATP synthase subunit a Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A1VF66 8.59e-13 69 30 6 210 3 atpB ATP synthase subunit a Nitratidesulfovibrio vulgaris (strain DP4)
Q72DL1 8.59e-13 69 30 6 210 3 atpB ATP synthase subunit a Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
C0MH74 9.57e-13 69 30 8 223 3 atpB ATP synthase subunit a Streptococcus equi subsp. zooepidemicus (strain H70)
B4U2D6 9.57e-13 69 30 8 223 3 atpB ATP synthase subunit a Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M715 9.57e-13 69 30 8 223 3 atpB ATP synthase subunit a Streptococcus equi subsp. equi (strain 4047)
A8EWC4 1e-12 69 29 8 230 3 atpB ATP synthase subunit a Aliarcobacter butzleri (strain RM4018)
Q02B01 1.13e-12 69 26 7 219 3 atpB ATP synthase subunit a Solibacter usitatus (strain Ellin6076)
Q30XV0 1.16e-12 69 29 7 211 3 atpB ATP synthase subunit a Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
P22476 1.31e-12 68 34 3 134 3 atpB ATP synthase subunit a Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
C5D9M1 1.38e-12 68 28 10 246 3 atpB ATP synthase subunit a Geobacillus sp. (strain WCH70)
Q6G5L2 1.42e-12 69 27 5 222 3 atpB ATP synthase subunit a Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q68XQ1 1.65e-12 68 26 5 230 3 atpB ATP synthase subunit a Rickettsia typhi (strain ATCC VR-144 / Wilmington)
C4XQ07 1.66e-12 68 27 7 229 3 atpB ATP synthase subunit a Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q92RM8 1.77e-12 68 25 5 235 3 atpB ATP synthase subunit a Rhizobium meliloti (strain 1021)
Q6G0H3 1.78e-12 68 26 5 222 3 atpB ATP synthase subunit a Bartonella quintana (strain Toulouse)
A8LKI0 1.91e-12 68 27 6 217 3 atpB ATP synthase subunit a Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q8CNJ1 2.01e-12 68 33 11 211 3 atpB ATP synthase subunit a Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HMB3 2.01e-12 68 33 11 211 3 atpB ATP synthase subunit a Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q1GU79 2.04e-12 68 27 7 238 3 atpB ATP synthase subunit a Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A8GLV8 2.33e-12 68 27 5 211 3 atpB ATP synthase subunit a Rickettsia akari (strain Hartford)
Q5WB72 2.39e-12 68 29 8 217 3 atpB ATP synthase subunit a Shouchella clausii (strain KSM-K16)
P56085 2.76e-12 67 30 8 231 3 atpB ATP synthase subunit a Helicobacter pylori (strain ATCC 700392 / 26695)
B2UT00 2.76e-12 67 30 8 231 3 atpB ATP synthase subunit a Helicobacter pylori (strain Shi470)
Q1CT41 2.76e-12 67 30 8 231 3 atpB ATP synthase subunit a Helicobacter pylori (strain HPAG1)
B5Z7J3 2.76e-12 67 30 8 231 3 atpB ATP synthase subunit a Helicobacter pylori (strain G27)
Q986D4 3.09e-12 68 28 7 229 3 atpB ATP synthase subunit a Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q07H86 3.1e-12 68 28 7 210 3 atpB ATP synthase subunit a Rhodopseudomonas palustris (strain BisA53)
Q11KH9 3.55e-12 68 30 6 210 3 atpB ATP synthase subunit a Chelativorans sp. (strain BNC1)
A6WW77 3.62e-12 68 26 5 210 3 atpB1 ATP synthase subunit a 1 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A5FVJ0 3.86e-12 67 28 5 225 3 atpB ATP synthase subunit a Acidiphilium cryptum (strain JF-5)
A6U6M4 4.16e-12 67 25 6 236 3 atpB ATP synthase subunit a Sinorhizobium medicae (strain WSM419)
Q3SW35 6.05e-12 67 27 6 210 3 atpB ATP synthase subunit a Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q7VG27 6.89e-12 67 31 9 218 3 atpB ATP synthase subunit a Helicobacter hepaticus (strain ATCC 51449 / 3B1)
A1URU2 7.22e-12 67 27 6 232 3 atpB ATP synthase subunit a Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
A7HQY7 7.3e-12 67 25 6 219 3 atpB ATP synthase subunit a Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q9ZL15 8.56e-12 66 29 8 231 3 atpB ATP synthase subunit a Helicobacter pylori (strain J99 / ATCC 700824)
B6JM59 8.56e-12 66 29 8 231 3 atpB ATP synthase subunit a Helicobacter pylori (strain P12)
Q6MAK1 9.93e-12 67 26 4 218 3 atpB ATP synthase subunit a Protochlamydia amoebophila (strain UWE25)
Q9ZEC1 1e-11 66 26 4 208 3 atpB ATP synthase subunit a Rickettsia prowazekii (strain Madrid E)
Q16AM8 1.05e-11 66 28 7 217 3 atpB ATP synthase subunit a Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A8HT64 1.18e-11 66 29 6 224 3 atpB ATP synthase subunit a Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
C3MHB5 1.22e-11 66 24 6 242 3 atpB ATP synthase subunit a Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B7GMF9 1.23e-11 66 27 10 232 3 atpB ATP synthase subunit a Anoxybacillus flavithermus (strain DSM 21510 / WK1)
P95784 1.45e-11 66 27 8 226 3 atpB ATP synthase subunit a Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A0LDW6 1.47e-11 66 30 9 234 3 atpB ATP synthase subunit a Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
B9JSF9 1.49e-11 66 28 6 214 3 atpB ATP synthase subunit a Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
A9CK03 1.54e-11 66 26 4 210 3 atpB ATP synthase subunit a Agrobacterium fabrum (strain C58 / ATCC 33970)
B3EQ98 1.56e-11 67 27 9 244 3 atpB ATP synthase subunit a Chlorobium phaeobacteroides (strain BS1)
Q20WZ8 1.9e-11 65 26 6 210 3 atpB ATP synthase subunit a Rhodopseudomonas palustris (strain BisB18)
Q0BQY7 2.04e-11 65 29 6 236 3 atpB ATP synthase subunit a Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q49Z56 2.15e-11 65 33 9 218 3 atpB ATP synthase subunit a Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q3B402 2.35e-11 65 24 6 198 3 atpB1 ATP synthase subunit a 1 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q0RDA8 2.85e-11 65 27 9 244 3 atpB ATP synthase subunit a Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q17WM4 3.63e-11 64 30 8 231 3 atpB ATP synthase subunit a Helicobacter acinonychis (strain Sheeba)
A5CDC5 3.75e-11 65 30 6 211 3 atpB ATP synthase subunit a Orientia tsutsugamushi (strain Boryong)
Q5FRW5 3.76e-11 65 28 6 222 3 atpB ATP synthase subunit a Gluconobacter oxydans (strain 621H)
Q1QRH8 3.9e-11 65 27 6 210 3 atpB ATP synthase subunit a Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
B1HM50 4.16e-11 64 33 6 142 3 atpB ATP synthase subunit a Lysinibacillus sphaericus (strain C3-41)
A9IQH9 4.54e-11 65 26 6 244 3 atpB ATP synthase subunit a Bartonella tribocorum (strain CIP 105476 / IBS 506)
A5VEV5 5.49e-11 64 27 6 215 3 atpB ATP synthase subunit a Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
B1XHZ3 5.77e-11 64 27 9 211 3 atpB1 ATP synthase subunit a 1 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
B3CQT9 6.22e-11 64 31 9 216 3 atpB ATP synthase subunit a Orientia tsutsugamushi (strain Ikeda)
Q2SNG4 6.42e-11 64 25 7 224 3 atpB1 ATP synthase subunit a 1 Hahella chejuensis (strain KCTC 2396)
A8L3V9 7.27e-11 64 27 8 229 3 atpB ATP synthase subunit a Parafrankia sp. (strain EAN1pec)
P50012 7.67e-11 64 26 7 241 3 atpB ATP synthase subunit a Streptomyces lividans
B3PRF6 8.5e-11 63 25 5 236 3 atpB ATP synthase subunit a Rhizobium etli (strain CIAT 652)
A6MVW9 9.41e-11 63 27 8 214 3 atpI ATP synthase subunit a, chloroplastic Rhodomonas salina
A6X1X3 1.01e-10 63 25 6 221 3 atpB2 ATP synthase subunit a 2 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q2KBW1 1.15e-10 63 26 5 223 3 atpB ATP synthase subunit a Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
A7ZD62 1.37e-10 63 29 7 214 3 atpB ATP synthase subunit a Campylobacter concisus (strain 13826)
B3QNH3 1.38e-10 63 22 7 210 3 atpB1 ATP synthase subunit a 1 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
O05097 1.39e-10 63 26 8 242 3 atpB ATP synthase subunit a Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B5ZS16 1.42e-10 63 25 5 236 3 atpB ATP synthase subunit a Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q03EK8 1.71e-10 63 25 12 284 3 atpB ATP synthase subunit a Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
O78480 2.25e-10 62 25 8 217 3 atpI ATP synthase subunit a, chloroplastic Guillardia theta
Q5NPR9 2.73e-10 62 28 7 226 3 atpB ATP synthase subunit a Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q1DFA0 3.5e-10 62 25 7 223 3 atpB ATP synthase subunit a Myxococcus xanthus (strain DK1622)
Q603U8 3.75e-10 62 24 7 222 3 atpB2 ATP synthase subunit a 2 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q6AQ29 3.91e-10 62 25 5 242 3 atpB ATP synthase subunit a Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A1AMA7 4.21e-10 62 25 6 197 3 atpB2 ATP synthase subunit a 2 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q0C0X3 5.07e-10 62 27 9 251 3 atpB ATP synthase subunit a Hyphomonas neptunium (strain ATCC 15444)
Q4L7Z0 5.13e-10 61 33 11 212 3 atpB ATP synthase subunit a Staphylococcus haemolyticus (strain JCSC1435)
B4S6E6 5.56e-10 62 28 7 232 3 atpB2 ATP synthase subunit a 2 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
B3QLV3 5.69e-10 62 28 8 216 3 atpB2 ATP synthase subunit a 2 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
B9E8F1 6.58e-10 61 29 10 238 3 atpB ATP synthase subunit a Macrococcus caseolyticus (strain JCSC5402)
Q2J6M7 6.9e-10 62 27 10 244 3 atpB ATP synthase subunit a Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q9TL13 7.6e-10 61 25 7 219 3 atpI ATP synthase subunit a, chloroplastic Nephroselmis olivacea
Q19VA2 8.27e-10 61 25 8 211 3 atpI ATP synthase subunit a, chloroplastic Chlorokybus atmophyticus
A6Q3A6 8.85e-10 60 28 7 216 3 atpB ATP synthase subunit a Nitratiruptor sp. (strain SB155-2)
C1A1Y4 9.62e-10 61 25 9 248 3 atpB ATP synthase subunit a Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q02847 1.13e-09 60 25 8 210 3 atpI ATP synthase subunit a, chloroplastic Antithamnion sp.
A5EBW8 1.15e-09 60 24 6 213 3 atpB2 ATP synthase subunit a 2 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q1MKT2 1.39e-09 60 25 4 210 3 atpB ATP synthase subunit a Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P21903 1.6e-09 60 28 7 219 3 atpB ATP synthase subunit a, sodium ion specific Propionigenium modestum
A6QAM3 2.05e-09 60 27 8 222 3 atpB ATP synthase subunit a Sulfurovum sp. (strain NBC37-1)
Q00825 2.13e-09 60 27 9 202 3 atpI ATP synthase subunit a, chloroplastic Trieres chinensis
Q6YXK0 2.16e-09 60 25 8 212 3 atpI ATP synthase subunit a, chloroplastic Physcomitrium patens
A8ZUM7 2.29e-09 59 28 4 200 3 atpB ATP synthase subunit a Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q9MUS9 2.35e-09 60 28 3 129 3 atpI ATP synthase subunit a, chloroplastic Mesostigma viride
Q2LCR6 2.93e-09 59 23 4 225 3 atp6 ATP synthase subunit a Dictyostelium citrinum
Q27559 3.16e-09 59 23 4 225 3 atp6 ATP synthase subunit a Dictyostelium discoideum
O66566 3.48e-09 58 27 7 207 3 atpB ATP synthase subunit a Aquifex aeolicus (strain VF5)
B1XRK3 3.99e-09 58 25 6 193 3 atpB2 ATP synthase subunit a 2 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
B4S798 4.37e-09 58 26 9 211 3 atpB1 ATP synthase subunit a 1 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q8KDL8 4.49e-09 58 21 7 210 3 atpB1 ATP synthase subunit a 1 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A5GND3 5.1e-09 58 28 8 202 3 atpB ATP synthase subunit a Synechococcus sp. (strain WH7803)
A2T320 5.56e-09 58 25 8 211 3 atpI ATP synthase subunit a, chloroplastic Angiopteris evecta
Q3AZM6 7.55e-09 58 28 8 213 3 atpB ATP synthase subunit a Synechococcus sp. (strain CC9902)
A8EX90 9.4e-09 58 29 6 209 3 atpB ATP synthase subunit a Rickettsia canadensis (strain McKiel)
A9HDN1 9.65e-09 58 31 6 222 3 atpB ATP synthase subunit a Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q37385 9.85e-09 58 30 10 231 3 ATP6 ATP synthase subunit a Acanthamoeba castellanii
Q30QW4 1.06e-08 57 29 9 215 3 atpB ATP synthase subunit a Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q8E077 1.31e-08 57 25 9 244 3 atpB ATP synthase subunit a Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3K1K0 1.31e-08 57 25 9 244 3 atpB ATP synthase subunit a Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
B1X3Y1 1.5e-08 57 33 5 130 3 atpI ATP synthase subunit a, organellar chromatophore Paulinella chromatophora
Q8E5V3 1.59e-08 57 25 9 244 3 atpB ATP synthase subunit a Streptococcus agalactiae serotype III (strain NEM316)
P06289 1.6e-08 57 25 8 211 3 atpI ATP synthase subunit a, chloroplastic Marchantia polymorpha
P92547 1.65e-08 58 27 9 230 2 ATP6-2 ATP synthase subunit a-2 Arabidopsis thaliana
C1C8A4 1.72e-08 57 27 11 251 3 atpB ATP synthase subunit a Streptococcus pneumoniae (strain 70585)
Q0I7Q7 1.75e-08 57 28 8 213 3 atpB ATP synthase subunit a Synechococcus sp. (strain CC9311)
C1CSD3 1.85e-08 57 27 11 251 3 atpB ATP synthase subunit a Streptococcus pneumoniae (strain Taiwan19F-14)
C1CLL1 1.85e-08 57 27 11 251 3 atpB ATP synthase subunit a Streptococcus pneumoniae (strain P1031)
C1CF98 1.85e-08 57 27 11 251 3 atpB ATP synthase subunit a Streptococcus pneumoniae (strain JJA)
P0A2Y9 1.85e-08 57 27 11 251 1 atpB ATP synthase subunit a Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IQX5 1.85e-08 57 27 11 251 3 atpB ATP synthase subunit a Streptococcus pneumoniae (strain CGSP14)
P0A2Y8 1.85e-08 57 27 11 251 3 atpB ATP synthase subunit a Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZLB4 1.85e-08 57 27 11 251 3 atpB ATP synthase subunit a Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1ICT4 1.85e-08 57 27 11 251 3 atpB ATP synthase subunit a Streptococcus pneumoniae (strain Hungary19A-6)
Q04HT4 1.85e-08 57 27 11 251 3 atpB ATP synthase subunit a Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P25965 1.98e-08 53 40 1 75 3 atpB ATP synthase subunit a (Fragment) Alkalihalobacillus alcalophilus
Q31720 2.11e-08 57 26 8 230 2 ATP6 ATP synthase subunit a Brassica napus
B5E676 2.22e-08 57 33 6 128 3 atpB ATP synthase subunit a Streptococcus pneumoniae serotype 19F (strain G54)
B2X1U8 2.26e-08 57 26 10 220 3 atpI ATP synthase subunit a, chloroplastic Oedogonium cardiacum
P93298 2.61e-08 57 27 9 230 2 ATP6-1 ATP synthase subunit a-1 Arabidopsis thaliana
Q3AHK0 2.87e-08 56 28 8 210 3 atpB ATP synthase subunit a Synechococcus sp. (strain CC9605)
A3CM09 3.13e-08 56 30 5 133 3 atpB ATP synthase subunit a Streptococcus sanguinis (strain SK36)
Q21ZA2 3.21e-08 56 30 4 129 3 atpB ATP synthase subunit a Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
P26853 3.6e-08 56 26 5 217 3 ATP6 ATP synthase subunit a Marchantia polymorpha
P41013 4.32e-08 56 32 7 137 3 atpB ATP synthase subunit a Bacillus caldotenax
Q7NCR8 5.34e-08 55 28 8 210 3 atpB ATP synthase subunit a Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q8WI28 5.59e-08 55 24 8 211 3 atpI ATP synthase subunit a, chloroplastic Psilotum nudum
P15995 6.5e-08 55 30 9 207 3 ATP6 ATP synthase subunit a Strongylocentrotus purpuratus
A7I1B2 6.82e-08 55 31 9 213 3 atpB ATP synthase subunit a Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q85AE6 7.71e-08 55 25 8 212 2 atpI ATP synthase subunit a, chloroplastic Anthoceros angustus
Q0H8Y6 7.78e-08 55 25 7 247 3 ATP6 ATP synthase subunit a Ustilago maydis (strain 521 / FGSC 9021)
Q06J71 8.67e-08 55 27 4 129 3 atpI ATP synthase subunit a, chloroplastic Bigelowiella natans
P48878 1.01e-07 55 24 6 248 3 ATP6 ATP synthase subunit a Chondrus crispus
Q40607 1.13e-07 54 28 7 154 3 atpI ATP synthase subunit a, chloroplastic Ochrosphaera neapolitana
Q112Z1 1.45e-07 54 26 6 203 3 atpB ATP synthase subunit a Trichodesmium erythraeum (strain IMS101)
Q1IS49 1.46e-07 54 26 6 203 3 atpB ATP synthase subunit a Koribacter versatilis (strain Ellin345)
A8AYG6 1.51e-07 54 26 10 251 3 atpB ATP synthase subunit a Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q1XDP0 1.66e-07 54 26 8 203 3 atpI ATP synthase subunit a, chloroplastic Neopyropia yezoensis
Q35915 1.7e-07 54 36 3 111 1 MT-ATP6 ATP synthase subunit a Sus scrofa
Q67TC3 1.72e-07 54 26 8 212 3 atpB ATP synthase subunit a Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A1B619 1.93e-07 54 27 6 211 1 atpB ATP synthase subunit a Paracoccus denitrificans (strain Pd 1222)
Q5X2Q6 1.96e-07 54 24 6 203 3 atpB ATP synthase subunit a Legionella pneumophila (strain Paris)
Q5ZWN4 2.3e-07 53 24 6 203 3 atpB ATP synthase subunit a Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
P51247 2.53e-07 53 26 8 203 3 atpI ATP synthase subunit a, chloroplastic Porphyra purpurea
A9FGS5 2.59e-07 53 23 6 235 3 atpB ATP synthase subunit a Sorangium cellulosum (strain So ce56)
P48662 2.89e-07 53 36 3 111 3 MT-ATP6 ATP synthase subunit a Equus caballus
Q6MRR3 3.88e-07 53 27 10 203 3 atpB ATP synthase subunit a Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
P05500 4.09e-07 53 27 9 229 2 ATP6 ATP synthase subunit a Oenothera berteroana
O03200 4.26e-07 53 36 3 110 3 MT-ATP6 ATP synthase subunit a Ceratotherium simum
A5IFJ6 5.82e-07 52 24 6 203 3 atpB ATP synthase subunit a Legionella pneumophila (strain Corby)
Q2JIF4 6.53e-07 52 26 8 203 3 atpB ATP synthase subunit a Synechococcus sp. (strain JA-2-3B'a(2-13))
A1SHI5 7.02e-07 52 27 10 281 3 atpB ATP synthase subunit a Nocardioides sp. (strain ATCC BAA-499 / JS614)
P92480 7.67e-07 52 35 3 111 3 MT-ATP6 ATP synthase subunit a Equus asinus
Q9T9W0 7.81e-07 52 25 5 204 3 MT-ATP6 ATP synthase subunit a Pan troglodytes
A6H5F5 7.88e-07 52 26 8 212 3 atpI ATP synthase subunit a, chloroplastic Cycas taitungensis
A0JY70 8.7e-07 52 31 12 236 3 atpB ATP synthase subunit a Arthrobacter sp. (strain FB24)
A5GV77 8.88e-07 52 29 10 201 3 atpB ATP synthase subunit a Synechococcus sp. (strain RCC307)
Q7U8X0 1.02e-06 52 31 7 151 3 atpB ATP synthase subunit a Parasynechococcus marenigrum (strain WH8102)
Q1ACN1 1.12e-06 52 24 9 224 3 atpI ATP synthase subunit a, chloroplastic Chara vulgaris

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_16545
Feature type CDS
Gene atpB
Product F0F1 ATP synthase subunit A
Location 61363 - 62187 (strand: -1)
Length 825 (nucleotides) / 274 (amino acids)

Contig

Accession ZDB_533
Length 80662 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2066
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00119 ATP synthase A chain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0356 Energy production and conversion (C) C FoF1-type ATP synthase, membrane subunit a

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02108 F-type H+-transporting ATPase subunit a Oxidative phosphorylation
Photosynthesis
Metabolic pathways		 F-type ATPase, prokaryotes and chloroplasts

Protein Sequence

MSASGESLTTKEYIGGHLNNLQLDLNTFELVNPHANATPSFWTLNIDSLFFSVVLGIFFLWLFRRVAKKATSGVPGKFQTAVEMLIGFVDSNVRDMYHGKSKVIAPLALTVFVWVLLMNALDLLPIDFIPYIGEHILGLPALRIVPTADVSITLSMAIGVFVLILFYSFKMKGVKGFAKELTLQPFNHPLFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWLLSLPWAIFHILIITLQAFIFMVLTIVYLSMASEEH

Flanking regions ( +/- flanking 50bp)

CGGCCGTGCTAAGCGGTTAGCGGTTTTAACAACAAAGGGTAAGAGGCATCATGTCTGCATCAGGAGAAAGTTTAACCACAAAAGAGTATATCGGTGGCCACCTGAATAACCTTCAGCTGGACCTGAATACTTTCGAGTTGGTCAATCCCCATGCGAACGCGACTCCATCTTTTTGGACGCTGAACATTGACTCCCTTTTCTTCTCAGTCGTATTAGGTATTTTCTTTTTATGGCTTTTCAGAAGGGTGGCAAAGAAAGCGACAAGTGGCGTTCCCGGGAAATTTCAGACTGCGGTAGAAATGCTTATCGGCTTCGTTGACAGCAACGTCCGTGATATGTATCACGGCAAGAGCAAGGTTATTGCACCTCTCGCATTAACTGTGTTCGTGTGGGTGCTGCTGATGAACGCACTGGACTTATTACCAATCGACTTCATTCCGTATATCGGTGAACACATCCTCGGTTTACCTGCGCTGCGTATCGTTCCGACCGCAGACGTAAGTATCACACTGTCGATGGCGATTGGTGTATTCGTTCTTATCCTCTTTTACAGCTTCAAGATGAAAGGCGTGAAAGGATTTGCAAAAGAGCTGACATTACAGCCTTTTAATCATCCGTTATTCATTCCTGTCAACCTGATTCTGGAAGGGGTAAGCCTGCTGTCAAAACCTGTTTCCCTCGGTCTGCGACTGTTTGGGAACATGTATGCAGGTGAGCTGATCTTCATTCTTATTGCAGGTCTGCTACCGTGGTGGTCACAATGGTTACTGAGCCTTCCGTGGGCGATTTTCCACATACTGATTATTACGTTACAAGCCTTTATTTTCATGGTTCTGACGATCGTCTATCTGTCGATGGCGTCTGAAGAGCATTAATTTTATTACCAATAACTGTGATTTAACTGAAACAAACTGGAGACTGTCAT