Homologs in group_71

Help

12 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15525 FBDBKF_15525 100.0 Morganella morganii S1 - hypothetical protein
FBDBKF_15530 FBDBKF_15530 - Morganella morganii S1 - Putative exported protein
EHELCC_15885 EHELCC_15885 100.0 Morganella morganii S2 - hypothetical protein
EHELCC_15890 EHELCC_15890 - Morganella morganii S2 - Putative exported protein
NLDBIP_16480 NLDBIP_16480 - Morganella morganii S4 - Putative exported protein
LHKJJB_16320 LHKJJB_16320 100.0 Morganella morganii S3 - hypothetical protein
LHKJJB_16325 LHKJJB_16325 - Morganella morganii S3 - Putative exported protein
HKOGLL_16090 HKOGLL_16090 100.0 Morganella morganii S5 - hypothetical protein
HKOGLL_16095 HKOGLL_16095 - Morganella morganii S5 - Putative exported protein
F4V73_RS17620 F4V73_RS17620 79.4 Morganella psychrotolerans - DUF2169 domain-containing protein
PMI_RS03705 PMI_RS03705 17.6 Proteus mirabilis HI4320 - DUF2169 domain-containing protein
PMI_RS05430 PMI_RS05430 14.7 Proteus mirabilis HI4320 - DUF2169 domain-containing protein

Distribution of the homologs in the orthogroup group_71

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_71

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_16485
Feature type CDS
Gene -
Product hypothetical protein
Location 48785 - 48889 (strand: 1)
Length 105 (nucleotides) / 34 (amino acids)
In genomic island -

Contig

Accession ZDB_533
Length 80662 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_71
Orthogroup size 13
N. genomes 7

Actions

Genomic region

Protein Sequence

MNLRKVFCTYRIALPESLNIAEMTLRHIQDHPAR

Flanking regions ( +/- flanking 50bp)

GATAACCTCAATTACTGGTGTGGTGCCCACCCGACACCGTCGTTGTGGACATGAACCTGAGAAAAGTGTTCTGCACTTACCGTATCGCTCTGCCGGAATCACTGAATATCGCCGAAATGACGCTGCGCCACATTCAGGATCATCCGGCCAGATAACCGGTACACATTTACCTTAAAAATGCCGCCATTGTCTTGACTGAAAATTA