Homologs in group_1987

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14905 FBDBKF_14905 100.0 Morganella morganii S1 yejL UPF0352 protein
EHELCC_15710 EHELCC_15710 100.0 Morganella morganii S2 yejL UPF0352 protein
LHKJJB_15600 LHKJJB_15600 100.0 Morganella morganii S3 yejL UPF0352 protein
HKOGLL_14720 HKOGLL_14720 100.0 Morganella morganii S5 yejL UPF0352 protein
F4V73_RS07705 F4V73_RS07705 94.7 Morganella psychrotolerans - YejL family protein
PMI_RS04045 PMI_RS04045 74.7 Proteus mirabilis HI4320 - YejL family protein

Distribution of the homologs in the orthogroup group_1987

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1987

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N351 1.09e-42 135 85 0 75 3 plu2871 UPF0352 protein plu2871 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q1C9C6 1.45e-40 130 84 0 75 3 YPA_0979 UPF0352 protein YPA_0979 Yersinia pestis bv. Antiqua (strain Antiqua)
B1JS47 1.45e-40 130 84 0 75 3 YPK_2797 UPF0352 protein YPK_2797 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FKA9 1.45e-40 130 84 0 75 3 YpsIP31758_2722 UPF0352 protein YpsIP31758_2722 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q1CG37 1.45e-40 130 84 0 75 3 YPN_2715 UPF0352 protein YPN_2715 Yersinia pestis bv. Antiqua (strain Nepal516)
A4TNE6 1.45e-40 130 84 0 75 3 YPDSF_2433 UPF0352 protein YPDSF_2433 Yersinia pestis (strain Pestoides F)
A9R3I1 1.45e-40 130 84 0 75 3 YpAngola_A1485 UPF0352 protein YpAngola_A1485 Yersinia pestis bv. Antiqua (strain Angola)
A1JLM5 1.45e-40 130 84 0 75 3 YE1420 UPF0352 protein YE1420 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2K9F0 1.45e-40 130 84 0 75 3 YPTS_1389 UPF0352 protein YPTS_1389 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q66CV5 1.45e-40 130 84 0 75 3 YPTB1297 UPF0352 protein YPTB1297 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZGM6 1.45e-40 130 84 0 75 3 YPO1261 UPF0352 protein YPO1261/y2923/YP_0880 Yersinia pestis
A4WCL8 3.97e-40 129 82 0 75 3 Ent638_2783 UPF0352 protein Ent638_2783 Enterobacter sp. (strain 638)
A9MK24 2.81e-39 127 81 0 75 3 yejL UPF0352 protein YejL Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q3Z020 6.54e-39 126 80 0 75 3 yejL UPF0352 protein YejL Shigella sonnei (strain Ss046)
Q31YZ4 6.54e-39 126 80 0 75 3 yejL UPF0352 protein YejL Shigella boydii serotype 4 (strain Sb227)
B2TV60 6.54e-39 126 80 0 75 3 yejL UPF0352 protein YejL Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6I186 6.54e-39 126 80 0 75 3 yejL UPF0352 protein YejL Escherichia coli (strain SE11)
B7N5F1 6.54e-39 126 80 0 75 3 yejL UPF0352 protein YejL Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0AD24 6.54e-39 126 80 0 75 1 yejL UPF0352 protein YejL Escherichia coli (strain K12)
B1IY82 6.54e-39 126 80 0 75 3 yejL UPF0352 protein YejL Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AD25 6.54e-39 126 80 0 75 3 yejL UPF0352 protein YejL Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8A251 6.54e-39 126 80 0 75 3 yejL UPF0352 protein YejL Escherichia coli O9:H4 (strain HS)
B1X885 6.54e-39 126 80 0 75 3 yejL UPF0352 protein YejL Escherichia coli (strain K12 / DH10B)
C4ZU32 6.54e-39 126 80 0 75 3 yejL UPF0352 protein YejL Escherichia coli (strain K12 / MC4100 / BW2952)
B7M537 6.54e-39 126 80 0 75 3 yejL UPF0352 protein YejL Escherichia coli O8 (strain IAI1)
B7MXK3 6.54e-39 126 80 0 75 3 yejL UPF0352 protein YejL Escherichia coli O81 (strain ED1a)
B5YWY1 6.54e-39 126 80 0 75 3 yejL UPF0352 protein YejL Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0AD26 6.54e-39 126 80 0 75 3 yejL UPF0352 protein YejL Escherichia coli O157:H7
B7LAL1 6.54e-39 126 80 0 75 3 yejL UPF0352 protein YejL Escherichia coli (strain 55989 / EAEC)
Q1R9N1 9.19e-39 125 78 0 75 3 yejL UPF0352 protein YejL Escherichia coli (strain UTI89 / UPEC)
B1LKT7 9.19e-39 125 78 0 75 3 yejL UPF0352 protein YejL Escherichia coli (strain SMS-3-5 / SECEC)
Q0TFQ2 9.19e-39 125 78 0 75 3 yejL UPF0352 protein YejL Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7NN02 9.19e-39 125 78 0 75 3 yejL UPF0352 protein YejL Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MFA2 9.19e-39 125 78 0 75 3 yejL UPF0352 protein YejL Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UFK4 9.19e-39 125 78 0 75 3 yejL UPF0352 protein YejL Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A8AE28 1.9e-38 125 77 0 75 3 CKO_00587 UPF0352 protein CKO_00587 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q32HY7 9.63e-38 123 78 0 75 3 yejL UPF0352 protein YejL Shigella dysenteriae serotype 1 (strain Sd197)
A7ZP12 1.2e-37 123 78 0 75 3 yejL UPF0352 protein YejL Escherichia coli O139:H28 (strain E24377A / ETEC)
Q83KD7 4.19e-37 121 77 0 75 3 yejL UPF0352 protein YejL Shigella flexneri
Q0T2T4 4.19e-37 121 77 0 75 3 yejL UPF0352 protein YejL Shigella flexneri serotype 5b (strain 8401)
C5BG56 2.08e-36 120 77 0 75 3 NT01EI_2610 UPF0352 protein NT01EI_2610 Edwardsiella ictaluri (strain 93-146)
B7LJT0 2.11e-36 119 74 0 75 3 yejL UPF0352 protein YejL Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q6D3J6 5.58e-35 116 73 1 76 3 ECA2748 UPF0352 protein ECA2748 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B2VII6 6.54e-35 116 74 0 75 3 ETA_12580 UPF0352 protein ETA_12580 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C6DEI9 6.95e-35 116 73 1 76 3 PC1_1633 UPF0352 protein PC1_1633 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B4ET91 9.6e-35 115 74 0 75 3 PMI0824 UPF0352 protein PMI0824 Proteus mirabilis (strain HI4320)
A6TBS1 2.89e-33 112 70 0 75 3 KPN78578_25810 UPF0352 protein KPN78578_25810 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A7MLM8 5.57e-33 111 72 0 75 3 ESA_01049 UPF0352 protein ESA_01049 Cronobacter sakazakii (strain ATCC BAA-894)
Q7CQ70 1.93e-32 110 82 0 75 3 yejL UPF0352 protein YejL Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XEL6 1.93e-32 110 82 0 75 3 yejL UPF0352 protein YejL Salmonella typhi
B4TPC9 1.93e-32 110 82 0 75 3 yejL UPF0352 protein YejL Salmonella schwarzengrund (strain CVM19633)
B5BE09 1.93e-32 110 82 0 75 3 yejL UPF0352 protein YejL Salmonella paratyphi A (strain AKU_12601)
C0Q0R3 1.93e-32 110 82 0 75 3 yejL UPF0352 protein YejL Salmonella paratyphi C (strain RKS4594)
A9N6F2 1.93e-32 110 82 0 75 3 yejL UPF0352 protein YejL Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PE23 1.93e-32 110 82 0 75 3 yejL UPF0352 protein YejL Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TAQ1 1.93e-32 110 82 0 75 3 yejL UPF0352 protein YejL Salmonella heidelberg (strain SL476)
B5RC66 1.93e-32 110 82 0 75 3 yejL UPF0352 protein YejL Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R197 1.93e-32 110 82 0 75 3 yejL UPF0352 protein YejL Salmonella enteritidis PT4 (strain P125109)
B5FNN3 1.93e-32 110 82 0 75 3 yejL UPF0352 protein YejL Salmonella dublin (strain CT_02021853)
Q57MB1 1.93e-32 110 82 0 75 3 yejL UPF0352 protein YejL Salmonella choleraesuis (strain SC-B67)
B5EYS9 1.93e-32 110 82 0 75 3 yejL UPF0352 protein YejL Salmonella agona (strain SL483)
B4SYR3 2.99e-32 109 82 0 75 3 yejL UPF0352 protein YejL Salmonella newport (strain SL254)
A7MUJ3 1.01e-21 82 54 0 75 3 VIBHAR_03027 UPF0352 protein VIBHAR_03027 Vibrio campbellii (strain ATCC BAA-1116)
Q87MV2 3.89e-21 81 53 0 75 1 VP2129 UPF0352 protein VP2129 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B7VLC8 4.1e-21 81 52 0 75 3 VS_0950 UPF0352 protein VS_0950 Vibrio atlanticus (strain LGP32)
Q8D866 1.21e-20 80 52 0 75 3 VV1_3121 UPF0352 protein VV1_3121 Vibrio vulnificus (strain CMCP6)
Q7MMA6 1.31e-20 80 52 0 75 3 VV1166 UPF0352 protein VV1166 Vibrio vulnificus (strain YJ016)
A5F6M2 1.81e-20 79 55 0 69 3 VC0395_A1625 UPF0352 protein VC0395_A1625/VC395_2155 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9KQF8 1.81e-20 79 55 0 69 3 VC_2040 UPF0352 protein VC_2040 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
C3LNZ1 1.81e-20 79 55 0 69 3 VCM66_1964 UPF0352 protein VCM66_1964 Vibrio cholerae serotype O1 (strain M66-2)
B5FFJ0 1.9e-20 79 49 0 75 3 VFMJ11_1769 UPF0352 protein VFMJ11_1769 Aliivibrio fischeri (strain MJ11)
Q5E4A2 1.9e-20 79 49 0 75 3 VF_1649 UPF0352 protein VF_1649 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6EIU9 7.41e-20 78 49 0 75 3 VSAL_I1058 UPF0352 protein VSAL_I1058 Aliivibrio salmonicida (strain LFI1238)
Q9CJV7 1.02e-19 77 47 0 74 3 PM1884 UPF0352 protein PM1884 Pasteurella multocida (strain Pm70)
A6VMF1 5.53e-19 75 47 0 71 3 Asuc_0778 UPF0352 protein Asuc_0778 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q65R93 6.18e-19 75 49 0 69 3 MS1910 UPF0352 protein MS1910 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A4SP90 6.41e-19 75 50 1 69 3 ASA_2693 UPF0352 protein ASA_2693 Aeromonas salmonicida (strain A449)
Q0I1R4 8.93e-19 75 47 0 73 3 HS_0229 UPF0352 protein HS_0229 Histophilus somni (strain 129Pt)
B0UV55 8.93e-19 75 47 0 73 3 HSM_0097 UPF0352 protein HSM_0097 Histophilus somni (strain 2336)
A0KIV0 5.31e-18 73 49 1 69 3 AHA_1665 UPF0352 protein AHA_1665 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B8F3K1 5.59e-18 73 47 1 74 3 HAPS_0210 UPF0352 protein HAPS_0210 Glaesserella parasuis serovar 5 (strain SH0165)
A8H3F0 8.56e-18 72 52 0 69 3 Spea_1764 UPF0352 protein Spea_1764 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q080H8 1.44e-17 72 50 0 69 3 Sfri_2492 UPF0352 protein Sfri_2492 Shewanella frigidimarina (strain NCIMB 400)
Q8EF26 1.85e-17 72 50 0 72 1 SO_2176 UPF0352 protein SO_2176 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B0TK50 4.16e-17 71 50 0 69 3 Shal_2512 UPF0352 protein Shal_2512 Shewanella halifaxensis (strain HAW-EB4)
B1KJ42 4.63e-17 70 50 0 69 3 Swoo_2786 UPF0352 protein Swoo_2786 Shewanella woodyi (strain ATCC 51908 / MS32)
Q12LR0 8.61e-17 70 50 0 69 3 Sden_2336 UPF0352 protein Sden_2336 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B8CNP8 9.26e-17 70 50 0 69 3 swp_2271 UPF0352 protein swp_2271 Shewanella piezotolerans (strain WP3 / JCM 13877)
A8FU97 2.05e-16 69 49 0 69 3 Ssed_1809 UPF0352 protein Ssed_1809 Shewanella sediminis (strain HAW-EB3)
A5UDN2 5.89e-16 68 43 0 69 3 CGSHiEE_07850 UPF0352 protein CGSHiEE_07850 Haemophilus influenzae (strain PittEE)
Q4QM60 5.89e-16 68 43 0 69 3 NTHI1007 UPF0352 protein NTHI1007 Haemophilus influenzae (strain 86-028NP)
Q6LP11 2.93e-15 66 41 0 68 3 PBPRA2586 UPF0352 protein PBPRA2586 Photobacterium profundum (strain SS9)
Q15QF3 6e-15 65 41 0 70 3 Patl_3379 UPF0352 protein Patl_3379 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A5UHY9 6.62e-15 65 42 0 69 3 CGSHiGG_07710 UPF0352 protein CGSHiGG_07710 Haemophilus influenzae (strain PittGG)
Q3IHD0 6.87e-15 65 43 0 69 3 PSHAa1818 UPF0352 protein PSHAa1818 Pseudoalteromonas translucida (strain TAC 125)
P44897 9.29e-15 65 42 0 69 1 HI_0840 UPF0352 protein HI_0840 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q481E4 3.98e-14 63 46 1 69 1 CPS_2611 UPF0352 protein CPS_2611 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A3MZV0 4.22e-14 63 42 1 70 3 APL_0584 UPF0352 protein APL_0584 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0BUE2 5.14e-14 63 42 1 70 3 APJL_0577 UPF0352 protein APJL_0577 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Q7VLE3 2.09e-12 59 37 1 70 3 HD_1515 UPF0352 protein HD_1515 Haemophilus ducreyi (strain 35000HP / ATCC 700724)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_16240
Feature type CDS
Gene yejL
Product UPF0352 protein
Location 112034 - 112261 (strand: 1)
Length 228 (nucleotides) / 75 (amino acids)

Contig

Accession ZDB_532
Length 116685 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1987
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF07208 Protein of unknown function (DUF1414)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3082 Function unknown (S) S Uncharacterized conserved protein YejL, UPF0352 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09904 uncharacterized protein - -

Protein Sequence

MPQSSRYSDEHVEKLLAELVSVLEKNRTPTDLSLMVLGNMVTNLINTSVAPSQRAHIAESFARALQSSVSEDKAH

Flanking regions ( +/- flanking 50bp)

CGCTCATCAGTTATGATATAGAGCTTTGTACAATCAGGATATCTACGTTTATGCCGCAATCATCCCGCTACAGTGATGAACACGTTGAAAAGTTACTGGCTGAGCTGGTCAGTGTGCTGGAAAAAAACCGGACACCGACCGACCTTTCTCTTATGGTGTTAGGAAATATGGTGACCAATCTCATCAATACCAGTGTTGCGCCGTCACAACGCGCTCATATTGCTGAATCCTTCGCCCGCGCCCTGCAATCTTCCGTCAGTGAAGATAAAGCGCACTGACCGCATTCCGGCTGACGACGAAATTCTATGGTAACGTATCGTCCGAAATA