Homologs in group_3568

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18665 FBDBKF_18665 100.0 Morganella morganii S1 - hypothetical protein
EHELCC_15240 EHELCC_15240 100.0 Morganella morganii S2 - hypothetical protein
LHKJJB_16070 LHKJJB_16070 100.0 Morganella morganii S3 - hypothetical protein
HKOGLL_15190 HKOGLL_15190 100.0 Morganella morganii S5 - hypothetical protein

Distribution of the homologs in the orthogroup group_3568

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3568

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_15770
Feature type CDS
Gene -
Product hypothetical protein
Location 18926 - 19033 (strand: -1)
Length 108 (nucleotides) / 35 (amino acids)

Contig

Accession ZDB_532
Length 116685 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3568
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MKYLAAATLFASAGFIAANGHDGWGWFLFVGVLIL

Flanking regions ( +/- flanking 50bp)

TTAATGACACGTCGTGAGATTGAGGAAATTGTATGTCACGGAGAACCGCGATGAAATATTTAGCAGCGGCGACATTGTTCGCATCGGCCGGATTTATTGCTGCAAATGGGCATGACGGGTGGGGATGGTTCCTTTTTGTCGGGGTGCTCATCCTATGAAAGAGATACTGATCGTCCTGGCTGTCTCTGCTTTTATCGCCCTGATATCC