Homologs in group_3375

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12190 FBDBKF_12190 100.0 Morganella morganii S1 - Autotransporter outer membrane beta-barrel domain-containing protein
EHELCC_14115 EHELCC_14115 100.0 Morganella morganii S2 - Autotransporter outer membrane beta-barrel domain-containing protein
LHKJJB_15400 LHKJJB_15400 100.0 Morganella morganii S3 - Autotransporter outer membrane beta-barrel domain-containing protein
HKOGLL_14520 HKOGLL_14520 100.0 Morganella morganii S5 - Autotransporter outer membrane beta-barrel domain-containing protein

Distribution of the homologs in the orthogroup group_3375

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3375

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9XD84 3.09e-26 104 44 0 107 1 tibA Autotransporter adhesin/invasin TibA Escherichia coli O78:H11 (strain H10407 / ETEC)
D2TV88 5.32e-25 100 42 0 107 1 CRAC Autotransporter CRAC Citrobacter rodentium (strain ICC168)
P33924 1.75e-11 62 30 1 108 5 yejO Putative uncharacterized outer membrane protein YejO Escherichia coli (strain K12)
P76000 2.68e-05 43 28 1 95 5 ycgI Putative uncharacterized protein YcgI Escherichia coli (strain K12)
Q8ZRF8 0.000279 42 29 3 108 3 yaiT Uncharacterized protein YaiT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q45340 0.000421 41 30 2 81 1 brkA BrkA autotransporter Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_15210
Feature type CDS
Gene -
Product Autotransporter outer membrane beta-barrel domain-containing protein
Location 42798 - 43121 (strand: -1)
Length 324 (nucleotides) / 107 (amino acids)
In genomic island -

Contig

Accession ZDB_531
Length 138641 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3375
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF03797 Autotransporter beta-domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3468 Cell wall/membrane/envelope biogenesis (M)
Intracellular trafficking, secretion, and vesicular transport (U)
MU Autotransporter adhesin AidA

Protein Sequence

MRADIHSADSFQGEAGALVSTSFEVRSAVLKPYARQAVVHEFTKENDVTINRTNTFSNDFSGSTGKYGQGLDAQITPQAAFYTEINYLNGNKRETPVSANLGFRVRF

Flanking regions ( +/- flanking 50bp)

AACTGTAGTATGCACGGATCGGCAGTGCGGATTATGAGCTGAACAACGGTATGCGTGCTGATATTCACAGTGCGGACAGTTTTCAGGGTGAAGCCGGTGCGCTGGTTTCCACGTCCTTTGAGGTCCGCAGTGCGGTGCTGAAACCGTATGCCCGCCAGGCGGTGGTTCACGAGTTCACCAAAGAGAATGATGTGACCATCAACCGCACCAATACCTTCAGCAACGATTTCTCCGGCAGCACCGGAAAATACGGCCAGGGACTGGATGCACAGATCACCCCGCAGGCTGCATTCTATACTGAAATCAATTACCTGAACGGTAATAAGCGTGAGACACCGGTCAGTGCGAATCTCGGCTTCCGGGTACGTTTCTGATCACACCACACTCAGTAAAACGCCCGGTAATTTCACCGGGCGTTTTACGA