Homologs in group_2758

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07535 FBDBKF_07535 100.0 Morganella morganii S1 eutS Ethanolamine utilization protein EutS, microcompartment shell protein
EHELCC_17205 EHELCC_17205 100.0 Morganella morganii S2 eutS Ethanolamine utilization protein EutS, microcompartment shell protein
LHKJJB_09040 LHKJJB_09040 100.0 Morganella morganii S3 eutS Ethanolamine utilization protein EutS, microcompartment shell protein
HKOGLL_08590 HKOGLL_08590 100.0 Morganella morganii S5 eutS Ethanolamine utilization protein EutS, microcompartment shell protein
F4V73_RS13585 F4V73_RS13585 93.7 Morganella psychrotolerans eutS ethanolamine utilization microcompartment protein EutS

Distribution of the homologs in the orthogroup group_2758

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2758

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P63748 8.09e-62 186 83 0 111 3 eutS Bacterial microcompartment shell protein EutS Shigella flexneri
P63746 8.09e-62 186 83 0 111 1 eutS Bacterial microcompartment shell protein EutS Escherichia coli (strain K12)
P63747 8.09e-62 186 83 0 111 3 eutS Bacterial microcompartment shell protein EutS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9ZFV7 2.03e-61 186 81 0 111 1 eutS Bacterial microcompartment shell protein EutS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z4T3 2.37e-60 183 81 0 111 3 eutS Bacterial microcompartment shell protein EutS Salmonella typhi
P0DUV8 9.64e-42 136 59 1 109 1 pduU Bacterial microcompartment shell protein PduU Citrobacter freundii
P0A1D1 2.73e-41 135 59 1 109 1 pduU Bacterial microcompartment shell protein PduU Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1D2 2.73e-41 135 59 1 109 3 pduU Bacterial microcompartment shell protein PduU Salmonella typhi
Q187M0 9.51e-38 126 52 1 111 1 eutS Bacterial microcompartment shell protein EutS Clostridioides difficile (strain 630)
A0A0E2IV13 1.81e-27 100 46 0 108 1 cutR Bacterial microcompartment shell protein CutR Streptococcus intermedius (strain ATCC 27335 / DSM 20573 / CCUG 32759 / CIP 103248 / JCM 12996 / LMG 17840 / NCTC 11324 / SK54 / 1877)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_13810
Feature type CDS
Gene eutS
Product Ethanolamine utilization protein EutS, microcompartment shell protein
Location 15352 - 15687 (strand: 1)
Length 336 (nucleotides) / 111 (amino acids)
In genomic island -

Contig

Accession ZDB_529
Length 159829 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2758
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00936 BMC domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4810 Amino acid transport and metabolism (E) E Ethanolamine utilization protein EutS, microcompartment shell protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K04031 ethanolamine utilization protein EutS - -

Protein Sequence

MEKERIIQEFVPGKQVTLAHLIAHPGSDLAKKIGVPGAEAIGIMTLTPGETAMIAGDLATKAAGVDIGFLDRFTGALVIYGSVGAVEEALIQTVRGLSQLLNYAVCDITRS

Flanking regions ( +/- flanking 50bp)

GTGACTAGGATTGAATCAATTCTTATGAGGAGAGTGACGAGGTAAGCACAATGGAAAAGGAACGTATCATCCAGGAATTTGTTCCCGGCAAACAGGTCACGCTGGCGCATCTGATTGCGCATCCGGGCAGTGATCTGGCGAAAAAAATCGGGGTTCCCGGTGCTGAAGCCATCGGCATTATGACGCTGACACCCGGCGAAACCGCAATGATTGCGGGTGATCTTGCCACAAAGGCCGCTGGTGTGGATATCGGCTTTCTTGATCGTTTCACCGGTGCGCTCGTGATTTACGGCTCTGTCGGCGCAGTGGAAGAAGCATTGATCCAGACTGTACGCGGGTTAAGCCAGCTCCTCAATTATGCCGTTTGTGATATCACCCGCAGCTGAGCGGGTGCAGTTAAGGATGCCGTCTGAATGAAACGAATTGTGTTTGTGGG