Homologs in group_1426

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08480 FBDBKF_08480 100.0 Morganella morganii S1 nsrR nitric oxide-sensing transcriptional repressor NsrR
EHELCC_13045 EHELCC_13045 100.0 Morganella morganii S2 nsrR nitric oxide-sensing transcriptional repressor NsrR
LHKJJB_13170 LHKJJB_13170 100.0 Morganella morganii S3 nsrR nitric oxide-sensing transcriptional repressor NsrR
HKOGLL_11860 HKOGLL_11860 100.0 Morganella morganii S5 nsrR nitric oxide-sensing transcriptional repressor NsrR
F4V73_RS09700 F4V73_RS09700 96.0 Morganella psychrotolerans nsrR nitric oxide-sensing transcriptional repressor NsrR
PMI_RS16775 PMI_RS16775 81.0 Proteus mirabilis HI4320 nsrR nitric oxide-sensing transcriptional repressor NsrR

Distribution of the homologs in the orthogroup group_1426

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1426

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F272 4.44e-73 217 81 0 125 3 nsrR HTH-type transcriptional repressor NsrR Proteus mirabilis (strain HI4320)
Q8ZKA3 2e-70 210 77 0 125 3 nsrR HTH-type transcriptional repressor NsrR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TSF8 2e-70 210 77 0 125 3 nsrR HTH-type transcriptional repressor NsrR Salmonella schwarzengrund (strain CVM19633)
B5BKI6 2e-70 210 77 0 125 3 nsrR HTH-type transcriptional repressor NsrR Salmonella paratyphi A (strain AKU_12601)
A9N4Z2 2e-70 210 77 0 125 3 nsrR HTH-type transcriptional repressor NsrR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PL57 2e-70 210 77 0 125 3 nsrR HTH-type transcriptional repressor NsrR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TFB2 2e-70 210 77 0 125 3 nsrR HTH-type transcriptional repressor NsrR Salmonella heidelberg (strain SL476)
B5R9C4 2e-70 210 77 0 125 3 nsrR HTH-type transcriptional repressor NsrR Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R0P4 2e-70 210 77 0 125 3 nsrR HTH-type transcriptional repressor NsrR Salmonella enteritidis PT4 (strain P125109)
Q57GL3 2e-70 210 77 0 125 3 nsrR HTH-type transcriptional repressor NsrR Salmonella choleraesuis (strain SC-B67)
B5F393 2e-70 210 77 0 125 3 nsrR HTH-type transcriptional repressor NsrR Salmonella agona (strain SL483)
Q3YUG5 1.87e-69 207 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Shigella sonnei (strain Ss046)
P0AF66 1.87e-69 207 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Shigella flexneri
Q0SXA4 1.87e-69 207 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Shigella flexneri serotype 5b (strain 8401)
Q328F7 1.87e-69 207 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Shigella dysenteriae serotype 1 (strain Sd197)
Q31TA8 1.87e-69 207 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Shigella boydii serotype 4 (strain Sb227)
B7LLW0 1.87e-69 207 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R382 1.87e-69 207 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Escherichia coli (strain UTI89 / UPEC)
B1LQJ8 1.87e-69 207 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Escherichia coli (strain SMS-3-5 / SECEC)
B7NGB2 1.87e-69 207 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0AF63 1.87e-69 207 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Escherichia coli (strain K12)
P0AF64 1.87e-69 207 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0T9L5 1.87e-69 207 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AJ83 1.87e-69 207 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Escherichia coli O1:K1 / APEC
B1XDS9 1.87e-69 207 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Escherichia coli (strain K12 / DH10B)
C4ZR55 1.87e-69 207 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Escherichia coli (strain K12 / MC4100 / BW2952)
B7MSJ6 1.87e-69 207 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Escherichia coli O81 (strain ED1a)
B7NTN4 1.87e-69 207 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P0AF65 1.87e-69 207 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Escherichia coli O157:H7
B7LC37 1.87e-69 207 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Escherichia coli (strain 55989 / EAEC)
B7MLI3 1.87e-69 207 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UQI7 1.87e-69 207 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q8Z183 2e-69 207 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Salmonella typhi
B2TY53 2.23e-69 207 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q7MYU4 2.43e-69 207 79 0 125 3 nsrR HTH-type transcriptional repressor NsrR Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B5Z2I4 9.48e-69 206 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q66FA9 1.15e-68 206 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CEG1 1.15e-68 206 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Yersinia pestis bv. Antiqua (strain Nepal516)
Q0WJT1 1.15e-68 206 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Yersinia pestis
Q1C106 1.15e-68 206 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Yersinia pestis bv. Antiqua (strain Antiqua)
A7FMX3 1.15e-68 206 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B6I282 2.84e-68 204 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Escherichia coli (strain SE11)
B1IT28 2.84e-68 204 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A7S3 2.84e-68 204 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Escherichia coli O9:H4 (strain HS)
B7M8T8 2.84e-68 204 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Escherichia coli O8 (strain IAI1)
A7ZV48 2.84e-68 204 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Escherichia coli O139:H28 (strain E24377A / ETEC)
C6DE26 5.66e-68 204 78 0 125 3 nsrR HTH-type transcriptional repressor NsrR Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A1JIS1 8.87e-68 203 75 0 125 3 nsrR HTH-type transcriptional repressor NsrR Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A4W5R9 2.54e-67 202 73 0 125 3 nsrR HTH-type transcriptional repressor NsrR Enterobacter sp. (strain 638)
A8G8V5 2.57e-67 202 75 0 125 3 nsrR HTH-type transcriptional repressor NsrR Serratia proteamaculans (strain 568)
A6TH94 9.27e-67 201 74 0 125 3 nsrR HTH-type transcriptional repressor NsrR Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5Y324 9.27e-67 201 74 0 125 3 nsrR HTH-type transcriptional repressor NsrR Klebsiella pneumoniae (strain 342)
Q6D125 4.85e-66 199 76 0 125 3 nsrR HTH-type transcriptional repressor NsrR Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6LM38 2.81e-54 169 64 0 122 3 nsrR HTH-type transcriptional repressor NsrR Photobacterium profundum (strain SS9)
B5FBQ6 8.53e-54 168 65 0 122 3 nsrR HTH-type transcriptional repressor NsrR Aliivibrio fischeri (strain MJ11)
Q5E2D6 8.53e-54 168 65 0 122 3 nsrR HTH-type transcriptional repressor NsrR Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7MH10 8.11e-52 163 62 0 122 3 nsrR HTH-type transcriptional repressor NsrR Vibrio vulnificus (strain YJ016)
Q8DCU1 8.11e-52 163 62 0 122 3 nsrR HTH-type transcriptional repressor NsrR Vibrio vulnificus (strain CMCP6)
B6EMP9 8.2e-52 163 60 0 122 3 nsrR HTH-type transcriptional repressor NsrR Aliivibrio salmonicida (strain LFI1238)
P40610 8.08e-51 160 63 0 122 3 nsrR HTH-type transcriptional repressor NsrR Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MX86 3.31e-49 156 63 0 122 3 nsrR HTH-type transcriptional repressor NsrR Vibrio campbellii (strain ATCC BAA-1116)
Q65M01 6.61e-32 112 46 3 126 3 nsrR HTH-type transcriptional regulator NsrR Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q5KZ63 1.59e-28 104 42 2 126 3 nsrR HTH-type transcriptional regulator NsrR Geobacillus kaustophilus (strain HTA426)
Q5WL64 3.64e-28 103 43 2 122 3 nsrR HTH-type transcriptional regulator NsrR Shouchella clausii (strain KSM-K16)
Q8ETG9 1.48e-25 97 37 2 122 3 nsrR HTH-type transcriptional regulator NsrR Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q9RC41 2.2e-25 96 40 2 122 3 nsrR HTH-type transcriptional regulator NsrR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O07573 6.27e-21 85 43 2 130 4 nsrR HTH-type transcriptional regulator NsrR Bacillus subtilis (strain 168)
Q9R9M8 9.08e-19 79 34 3 123 3 aau3 Protein aau3 Rhizobium meliloti (strain 1021)
Q9L132 2.71e-16 73 39 2 114 1 nsrR HTH-type transcriptional repressor NsrR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P33395 5.8e-10 56 30 2 107 4 rrf2 Protein rrf2 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
O68025 1.72e-09 55 29 2 120 4 RCAP_rcc02142 Putative HTH-type transcriptional regulator rrf2-like Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
A7MU47 3.92e-08 52 29 4 112 3 iscR HTH-type transcriptional regulator IscR Vibrio campbellii (strain ATCC BAA-1116)
Q87S29 9.07e-08 51 29 4 112 3 iscR HTH-type transcriptional regulator IscR Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MNG3 1.01e-07 51 30 4 110 3 iscR HTH-type transcriptional regulator IscR Vibrio vulnificus (strain YJ016)
Q8DEY6 1.01e-07 51 30 4 110 3 iscR HTH-type transcriptional regulator IscR Vibrio vulnificus (strain CMCP6)
B7VJS5 1.51e-07 50 28 4 112 3 iscR HTH-type transcriptional regulator IscR Vibrio atlanticus (strain LGP32)
B2VI31 4.7e-07 49 30 4 110 3 iscR HTH-type transcriptional regulator IscR Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q6LU63 4.92e-07 49 29 4 109 3 iscR HTH-type transcriptional regulator IscR Photobacterium profundum (strain SS9)
Q9KTY3 1.59e-06 48 28 4 112 3 iscR HTH-type transcriptional regulator IscR Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A1JKQ1 1.9e-06 47 29 5 115 3 iscR HTH-type transcriptional regulator IscR Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q667Y0 2.78e-06 47 29 5 115 3 iscR HTH-type transcriptional regulator IscR Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TMV5 2.78e-06 47 29 5 115 3 iscR HTH-type transcriptional regulator IscR Yersinia pestis (strain Pestoides F)
Q1CKB0 2.78e-06 47 29 5 115 3 iscR HTH-type transcriptional regulator IscR Yersinia pestis bv. Antiqua (strain Nepal516)
A9R819 2.78e-06 47 29 5 115 3 iscR HTH-type transcriptional regulator IscR Yersinia pestis bv. Antiqua (strain Angola)
Q0WD07 2.78e-06 47 29 5 115 3 iscR HTH-type transcriptional regulator IscR Yersinia pestis
Q1C5G9 2.78e-06 47 29 5 115 3 iscR HTH-type transcriptional regulator IscR Yersinia pestis bv. Antiqua (strain Antiqua)
A7FFX0 2.78e-06 47 29 5 115 3 iscR HTH-type transcriptional regulator IscR Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
C6DBJ2 3.28e-06 47 29 4 112 3 iscR HTH-type transcriptional regulator IscR Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q3J0R9 3.71e-06 46 32 0 61 1 RSP_0443 HTH-type transcriptional regulator IscR Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q6D258 4.75e-06 46 29 4 112 3 iscR HTH-type transcriptional regulator IscR Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P44675 5.3e-06 46 29 4 112 4 HI_0379 Putative HTH-type transcriptional regulator HI_0379 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B6EGX4 6.97e-06 46 25 2 107 3 iscR HTH-type transcriptional regulator IscR Aliivibrio salmonicida (strain LFI1238)
A8GHY4 9.15e-06 45 29 4 112 3 iscR HTH-type transcriptional regulator IscR Serratia proteamaculans (strain 568)
Q48660 2.23e-05 44 26 1 134 4 yffB Putative HTH-type transcriptional regulator YffB Lactococcus lactis subsp. lactis (strain IL1403)
O34527 3.13e-05 43 26 3 116 1 cymR HTH-type transcriptional regulator CymR Bacillus subtilis (strain 168)
P0AGL1 3.41e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Shigella flexneri
Q0T1Y8 3.41e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Shigella flexneri serotype 5b (strain 8401)
Q32D33 3.41e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Shigella dysenteriae serotype 1 (strain Sd197)
Q31XV9 3.41e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Shigella boydii serotype 4 (strain Sb227)
B2TXV6 3.41e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LJQ3 3.41e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R8K1 3.41e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Escherichia coli (strain UTI89 / UPEC)
B1LNI7 3.41e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Escherichia coli (strain SMS-3-5 / SECEC)
B7N6B8 3.41e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0AGK8 3.41e-05 44 31 0 57 1 iscR HTH-type transcriptional regulator IscR Escherichia coli (strain K12)
P0AGK9 3.41e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TEV4 3.41e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AE68 3.41e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Escherichia coli O1:K1 / APEC
B1XB06 3.41e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Escherichia coli (strain K12 / DH10B)
C4ZXA6 3.41e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Escherichia coli (strain K12 / MC4100 / BW2952)
B7MYG4 3.41e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Escherichia coli O81 (strain ED1a)
B7NRI0 3.41e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z105 3.41e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0AGL0 3.41e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Escherichia coli O157:H7
B7LDC3 3.41e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Escherichia coli (strain 55989 / EAEC)
B7MIM1 3.41e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UGX7 3.41e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZPX5 3.41e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Escherichia coli O139:H28 (strain E24377A / ETEC)
Q3YZ21 3.55e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Shigella sonnei (strain Ss046)
B6I5A3 3.55e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Escherichia coli (strain SE11)
B1IWD0 3.55e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A337 3.55e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Escherichia coli O9:H4 (strain HS)
B7M7N4 3.55e-05 44 31 0 57 3 iscR HTH-type transcriptional regulator IscR Escherichia coli O8 (strain IAI1)
B5XNJ6 3.89e-05 43 31 0 57 3 iscR HTH-type transcriptional regulator IscR Klebsiella pneumoniae (strain 342)
C5BEU6 4.02e-05 43 28 4 110 3 iscR HTH-type transcriptional regulator IscR Edwardsiella ictaluri (strain 93-146)
A8AD51 4.92e-05 43 31 0 57 3 iscR HTH-type transcriptional regulator IscR Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5F1C1 5.02e-05 43 31 0 57 3 iscR HTH-type transcriptional regulator IscR Salmonella agona (strain SL483)
Q2NS30 5.08e-05 43 28 4 112 3 iscR HTH-type transcriptional regulator IscR Sodalis glossinidius (strain morsitans)
A4WDB2 5.34e-05 43 31 0 57 3 iscR HTH-type transcriptional regulator IscR Enterobacter sp. (strain 638)
Q7CQ10 6.03e-05 43 31 0 57 3 iscR HTH-type transcriptional regulator IscR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XF25 6.03e-05 43 31 0 57 3 iscR HTH-type transcriptional regulator IscR Salmonella typhi
B4TRX7 6.03e-05 43 31 0 57 3 iscR HTH-type transcriptional regulator IscR Salmonella schwarzengrund (strain CVM19633)
B5BAW5 6.03e-05 43 31 0 57 3 iscR HTH-type transcriptional regulator IscR Salmonella paratyphi A (strain AKU_12601)
C0PYK6 6.03e-05 43 31 0 57 3 iscR HTH-type transcriptional regulator IscR Salmonella paratyphi C (strain RKS4594)
A9N1X3 6.03e-05 43 31 0 57 3 iscR HTH-type transcriptional regulator IscR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PNG2 6.03e-05 43 31 0 57 3 iscR HTH-type transcriptional regulator IscR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T1C0 6.03e-05 43 31 0 57 3 iscR HTH-type transcriptional regulator IscR Salmonella newport (strain SL254)
B4TDB7 6.03e-05 43 31 0 57 3 iscR HTH-type transcriptional regulator IscR Salmonella heidelberg (strain SL476)
B5RD13 6.03e-05 43 31 0 57 3 iscR HTH-type transcriptional regulator IscR Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R5A3 6.03e-05 43 31 0 57 3 iscR HTH-type transcriptional regulator IscR Salmonella enteritidis PT4 (strain P125109)
B5FR87 6.03e-05 43 31 0 57 3 iscR HTH-type transcriptional regulator IscR Salmonella dublin (strain CT_02021853)
Q57LG8 6.03e-05 43 31 0 57 3 iscR HTH-type transcriptional regulator IscR Salmonella choleraesuis (strain SC-B67)
A6TCF2 6.41e-05 43 31 0 57 3 iscR HTH-type transcriptional regulator IscR Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A9MHJ3 6.68e-05 43 31 0 57 3 iscR HTH-type transcriptional regulator IscR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
O69219 0.00012 42 27 5 118 4 None Putative HTH-type transcriptional regulator ORF2 Azotobacter vinelandii
A7MGX6 0.000146 42 31 0 57 3 iscR HTH-type transcriptional regulator IscR Cronobacter sakazakii (strain ATCC BAA-894)
Q8GLE9 0.000165 42 26 4 112 3 iscR HTH-type transcriptional regulator IscR Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / CCUG 14189 / LMG 1036 / NCIMB 9965 / AN6)
Q55433 0.000245 41 26 1 115 4 slr0846 Putative HTH-type transcriptional regulator slr0846 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q7N223 0.000327 41 29 2 77 3 iscR HTH-type transcriptional regulator IscR Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
O66625 0.000498 40 26 0 57 4 aq_268 Putative HTH-type transcriptional regulator aq_268 Aquifex aeolicus (strain VF5)
P67160 0.000512 40 26 4 116 4 BQ2027_MB1318 Putative HTH-type transcriptional regulator Mb1318 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WME3 0.000512 40 26 4 116 1 Rv1287 Putative HTH-type transcriptional regulator Rv1287 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WME2 0.000512 40 26 4 116 4 MT1325 Putative HTH-type transcriptional regulator MT1325 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_13385
Feature type CDS
Gene nsrR
Product nitric oxide-sensing transcriptional repressor NsrR
Location 86018 - 86398 (strand: -1)
Length 381 (nucleotides) / 126 (amino acids)
In genomic island -

Contig

Accession ZDB_528
Length 162442 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1426
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02082 Iron-dependent Transcriptional regulator

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1959 Transcription (K) K DNA-binding transcriptional regulator, IscR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K13771 Rrf2 family transcriptional regulator, nitric oxide-sensitive transcriptional repressor - -

Protein Sequence

MASLPDGKMTSITEVTDVYGVSRNHMVKIINQLSHLGYVEAIRGKNGGIRLGKPANTIGIGEVVRALEPLTLVNCSGEFCHITPACRLKSVLNKAIREFLQELDKHTLADMVQDNQHLYKLLLTDE

Flanking regions ( +/- flanking 50bp)

ATGTGCAGTTAACCAGTTTTACAGATTATGGCTTGCGGGCGCTGATTTATATGGCGTCACTTCCTGATGGTAAAATGACCAGTATTACGGAAGTGACGGACGTTTACGGCGTATCGCGTAACCATATGGTCAAGATAATTAACCAATTGAGCCATTTGGGTTATGTCGAGGCGATTCGCGGCAAAAATGGCGGGATCCGCCTGGGAAAACCTGCTAATACTATAGGTATCGGTGAGGTTGTCCGCGCGCTCGAGCCGTTAACACTGGTGAACTGCAGCGGTGAATTCTGTCACATTACTCCGGCATGCAGACTGAAATCGGTACTGAATAAAGCCATCCGGGAGTTCTTACAGGAACTGGATAAACACACGCTCGCTGATATGGTGCAGGACAATCAGCATCTTTATAAATTGTTACTGACGGACGAATAACGCCGGTCAGAAACCACGGAGGATACAATGTCAGTGGAAAAACAATCAAA